1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. Ubiquitin Enzymes
  4. E2 Enzymes
  5. Ubiquitin conjugating enzyme E2 S
  6. UBE2S Protein, Human (GST)

The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UBE2S protein is critical in cellular ubiquitination, accepting ubiquitin from the E1 complex and catalyzing covalent attachment to various proteins.UBE2S is a key contributor to cell cycle regulation, catalyzing "Lys-11"-linked polyubiquitination, which is critical for anaphase-promoting complex/cyclosome (APC/C) function.UBE2S Protein, Human (GST) is the recombinant human-derived UBE2S protein, expressed by E.coli , with N-GST labeled tag.

Background

UBE2S, a pivotal player in cellular ubiquitination processes, accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to various proteins. A key contributor to cell cycle regulation, UBE2S catalyzes 'Lys-11'-linked polyubiquitination, particularly as an essential factor of the anaphase promoting complex/cyclosome (APC/C). In this context, UBE2S plays a crucial role in mitotic progression by specifically elongating 'Lys-11'-linked polyubiquitin chains initiated by the E2 enzyme UBE2C/UBCH10 on APC/C substrates, leading to enhanced degradation of these substrates by the proteasome and facilitating mitotic exit. Additionally, UBE2S is implicated in the ubiquitination and subsequent degradation of VHL, resulting in the accumulation of HIF1A. In vitro studies reveal UBE2S's ability to promote polyubiquitination using all seven ubiquitin Lys residues, except for 'Lys-48'-linked polyubiquitination, underscoring its versatility in ubiquitin chain formation.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q16763 (M1-L222)

Gene ID
Molecular Construction
N-term
GST
UBE2S (M1-L222)
Accession # Q16763
C-term
Protein Length

Full Length

Synonyms
Ubiquitin-Conjugating Enzyme E2 S; E2-EPF; Ubiquitin Carrier Protein S; Ubiquitin-Conjugating Enzyme E2-24 kDa; Ubiquitin-Conjugating Enzyme E2-EPF5; Ubiquitin-Protein Ligase S; UBE2S; E2EPF
AA Sequence

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAKKKTDKKRALRRL

Predicted Molecular Mass
50.1 kDa
Molecular Weight

Approximately 50 kDa,based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2S Protein, Human (GST)
Cat. No.:
HY-P71408
Quantity:
MCE Japan Authorized Agent: