1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. TRIM/RBCC Proteins
  6. TRIM24 Protein, Human (P. pastoris, His)

TRIM24 protein is a multifunctional coactivator that dynamically interacts with nuclear receptors and coactivators to influence target gene transcription. It binds preferentially to unmodified H3K4me0 and acetylated H3K23. TRIM24 Protein, Human (P. pastoris, His) is the recombinant human-derived TRIM24 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TRIM24 protein is a multifunctional coactivator that dynamically interacts with nuclear receptors and coactivators to influence target gene transcription. It binds preferentially to unmodified H3K4me0 and acetylated H3K23. TRIM24 Protein, Human (P. pastoris, His) is the recombinant human-derived TRIM24 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

TRIM24, a versatile transcriptional coactivator, dynamically interacts with numerous nuclear receptors and coactivators, influencing the transcriptional landscape of target genes. Its binding to chromatin is notably influenced by histone H3 modifications, showing a preference for histone H3 that is unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Beyond its coactivator role, TRIM24 exhibits E3 protein-ubiquitin ligase activity. In the DNA damage response, a regulatory interplay unfolds wherein ATM kinase phosphorylates TRIM24 early in the response, leading to its ubiquitination and degradation. Upon sufficient DNA repair, TP53 activates TRIM24 transcription, initiating a feedback loop that results in TRIM24-mediated TP53 ubiquitination and degradation. This dual regulatory mechanism underscores TRIM24's pivotal role in the delicate balance between cell proliferation and apoptosis. Furthermore, TRIM24 extends its influence to innate immunity by orchestrating the 'Lys-63'-linked ubiquitination of TRAF3, activating downstream signaling in the type I IFN pathway. Notably, TRIM24 also exerts a negative regulatory effect on NLRP3/CASP1/IL-1beta-mediated pyroptosis and cell migration, possibly through the ubiquitination of NLRP3.

Species

Human

Source

P. pastoris

Tag

N-6*His

Accession

O15164 (K891-K1012)

Gene ID
Molecular Construction
N-term
6*His
TRIM24 (K891-K1012)
Accession # O15164
C-term
Synonyms
TRIM24; tripartite motif containing 24; TIF1, transcriptional intermediary factor 1 , tripartite motif containing 24; transcription intermediary factor 1-alpha; hTIF1; RNF82; TIF1A; Tif1a; TIF1-alpha; RING finger protein 82; tripartite motif-containing 24; E3 ubiquitin-protein ligase TRIM24; transcriptional intermediary factor 1; PTC6; TF1A; TIF1; TIF1ALPHA;
AA Sequence

KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK

Molecular Weight

16.5 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TRIM24 Protein, Human (P. pastoris, His)
Cat. No.:
HY-P700503
Quantity:
MCE Japan Authorized Agent: