1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TL1A
  6. TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His)

TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His)

Cat. No.: HY-P701047
Handling Instructions Technical Support

The TL1A/TNFSF15 protein is an important member of the tumor necrosis factor family and is critical for immune regulation and cellular responses. Its study enhances our understanding of immune regulation, providing potential applications for immunoassay and therapeutic development. TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived TL1A/TNFSF15 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TL1A/TNFSF15 protein is an important member of the tumor necrosis factor family and is critical for immune regulation and cellular responses. Its study enhances our understanding of immune regulation, providing potential applications for immunoassay and therapeutic development. TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque, cynomolgus-derived TL1A/TNFSF15 protein, expressed by HEK293 , with N-His labeled tag.

Background

The TL1A/TNFSF15 Protein is a significant member of the tumor necrosis factor family, underlining its essential role in immune regulation and cellular responses. As part of this family, TL1A/TNFSF15 Trimer likely shares conserved structural and functional features with related proteins, emphasizing its involvement in signaling pathways associated with immune modulation. The classification within the tumor necrosis factor family underscores its specific designation within the broader context of cytokines, providing insights into its unique contributions to T cell activation and co-stimulation. The study of TL1A/TNFSF15 Trimer Protein contributes to our understanding of its role in immune homeostasis, offering potential applications in various immunological assays and therapeutic developments. Further exploration of TL1A/TNFSF15 Trimer's role holds promise for enhancing our knowledge of its contributions to both normal immune function and pathological conditions.

Biological Activity

1.Immobilized Cynomolgus/Rhesus macaque TNFSF15, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-TNFSF15 Antibody, hFc Tag with the ED50 of <6 ng/mL determined by ELISA.
2.Mouse DR3 (HY-P700707), His Tag immobilized on CM5 Chip can bind Cynomolgus/Rhesus macaque TNFSF15, His Tag with an affinity constant of 5.117 nM as determined in SPR assay.
3. Immobilized Cynomolgus TNFSF15 Trimer at 2μg/mL (100 μL/Well) can bind Anti-TNFSF15 Antibody. The ED50 for this effect is 5.292 ng/mL.

  • Mouse DR3(HY-P700707), His Tag immobilized on CM5 Chip can bind Cynomolgus/Rhesus macaque TNFSF15, His Tag with an affinity constant of 5.117 nM as determined in SPR assay.
Species

Rhesus Macaque; Cynomolgus

Source

HEK293

Tag

N-His

Accession

F6S8F9-1/A0A2K5UA22 (L72-L251)

Gene ID
Molecular Construction
N-term
His
TL1A (L72-L251)
Accession # F6S8F9-1/A0A2K5UA22
C-term
Protein Length

Partial

Synonyms
TL1A; VEGI-251; TNFSF15; TL1; VEGI; VEGI192A; TNF superfamily member 15
AA Sequence

LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Predicted Molecular Mass
21.5 kDa
Molecular Weight

Approximately 24-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4-8.0). Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TL1A/TNFSF15 Protein, Cynomolgus/Rhesus macaque (HEK293, His)
Cat. No.:
HY-P701047
Quantity:
MCE Japan Authorized Agent: