SULT1A1 Protein, Human (His)

SULT1A1 Protein, Human (His) is the recombinant human-derived SULT1A1 protein, expressed by E. coli, with N-6*His labeled tag.

SULT1A1 is a sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as a sulfonate donor to catalyze the sulfate conjugation of various hydroxyl- or amine-bearing acceptor molecules. Sulfonation enhances water solubility (facilitating renal excretion) but may also bioactivate compounds. It exhibits broad substrate specificity for small phenolic compounds and plays key roles in sulfating endogenous molecules including steroid hormones, dopamine, and thyroid hormones (T4/T3/rT3/3,3'-T2 with preference for 3,3'-T2). This enzyme mediates xenobiotic sulfation (e.g. drugs acetaminophen and minoxidil, by similarity) and metabolic activation of carcinogenic N-hydroxyarylamines into DNA-adduct-forming intermediates. Recent findings suggest its involvement in gut microbiota-host interactions through O-sulfonation of bacterial metabolite 4-ethylphenol (4-EP), which may cross the blood-brain barrier and modulate oligodendrocyte maturation, potentially affecting limbic system connectivity.

Measured by its ability to transfer sulfate from PAPS to 1-Napthol. The specific activity is 56.4 pmol/min/μg.

Human

E. coli

N-6*His

AAH00923.1 (M1-L295)

6817  [NCBI]

Full Length

MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKAPGIPSGMETLKDTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVHPEPGTWDSFLEKFMVGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGHSLPEETVDFVVQHTSFKEMKKNPMTNYTTVPQEFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Approximately 32-34 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM PB, 10% Trehalose, 50 mM Nacl, 0.05% Tween 80, pH 7.8 or 50 mM PB, 50 mM NaCl, pH 7.8, 10% Glycerol, 10% trehalose and 0.05% Tween80.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.