1. Recombinant Proteins
  2. CD Antigens
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins
  4. Syndecan-2/CD362
  5. Syndecan-2 Protein, Human (HEK293, His)

Syndecan-2 Protein is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. Syndecan-2 functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Syndecan-2 is necessary for tumor angiogenesis that facilitates tumor growth and metastasis. Syndecan-2 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-2 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Syndecan-2 Protein is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. Syndecan-2 functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Syndecan-2 is necessary for tumor angiogenesis that facilitates tumor growth and metastasis. Syndecan-2 Protein, Human (HEK293, His) is the recombinant human-derived Syndecan-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Syndecan-2 is a transmembrane (type I) heparan sulfate proteoglycan and is a member of the syndecan proteoglycan family. Syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. Syndecan-2 functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Increased expression of Syndecan-2 may directly relate to loss of cell/substrate interactions and contact inhibition and contribute to both the tumorigenic and metastatic potential in cancer cells. Syndecan-2 is necessary for tumor angiogenesis that facilitates tumor growth and metastasis. Syndecan-2 is a novel marker of hematopoietic stem cell (HSC) that regulates HSC repopulating capacity through control of expression of Cdkn1c (p57) and HSC quiescence. In addition, Syndecan-2 inhibits α-SMA expression, cell contraction, proliferation, and migration induced by TGF-β1 in mouse lung fibroblasts[1][2][3].

Species

Human

Source

HEK293

Tag

C-6*His

Accession

AAH49836.1 (E19-E144)

Gene ID
Molecular Construction
N-term
Syndecan-2 (E19-E144)
Accession # AAH49836.1
6*His
C-term
Protein Length

Partial

Synonyms
Syndecan-2; SYND2; Fibroglycan; Heparan Sulfate Proteoglycan Core Protein; HSPG; CD362; SDC2; HSPG1
AA Sequence

ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE

Molecular Weight

25-40 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Syndecan-2 Protein, Human (HEK293, His)
Cat. No.:
HY-P70995
Quantity:
MCE Japan Authorized Agent: