1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. RuvC Protein, E.coli (His-SUMO)

RuvC protein is an important component of the RuvA-RuvB-RuvC complex and is essential for the processing of Holliday junctions in gene recombination and DNA repair. As an endonuclease, RuvC resolves Holliday junctions by generating symmetric single-stranded nicks that rely on a central homology core. RuvC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvC protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RuvC protein is an important component of the RuvA-RuvB-RuvC complex and is essential for the processing of Holliday junctions in gene recombination and DNA repair. As an endonuclease, RuvC resolves Holliday junctions by generating symmetric single-stranded nicks that rely on a central homology core. RuvC Protein, E.coli (His-SUMO) is the recombinant E. coli-derived RuvC protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

The RuvC protein is an essential component of the RuvA-RuvB-RuvC complex, which plays a crucial role in processing Holliday junctions during genetic recombination and DNA repair. As an endonuclease, RuvC resolves Holliday junction (HJ) intermediates by making single-stranded nicks across the junction at symmetrical positions within the homologous arms. This cleavage results in the generation of a 5'-phosphate and a 3'-hydroxyl group and is dependent on the presence of a central core of homology in the junction. The consensus cleavage sequence for RuvC is 5'-(A/T)TT(C>G/A)-3', with cleavage occurring on the 3'-side of the TT dinucleotide at the point of strand exchange. Notably, the cleavage reactions can be uncoupled, requiring the presence of two consensus cleavage sequences. RuvC binds to cruciform DNA in a sequence non-specific manner. In conjunction with RuvA and RuvB, RuvC forms a complex that enhances the rate of strand exchange (branch migration), dissociates the RecA filament, and facilitates cleavage in both orientations at the cruciform junction. The HJ-RuvA-RuvB-RuvC complexes not only resolve Holliday junctions but also undergo branch migration, demonstrating a coupled branch migration/HJ resolution reaction. This comprehensive enzymatic activity of RuvC underscores its pivotal role in the intricate machinery of DNA repair and recombination.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

E.coli

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P0A814 (A2-R173)

Gene ID

946378  [NCBI]

Molecular Construction
N-term
6*His-SUMO
RuvC (A2-R173)
Accession # P0A814
C-term
Protein Length

Full Length of Mature Protein

Synonyms
ruvC; b1863; JW1852; Crossover junction endodeoxyribonuclease RuvC; EC 3.1.22.4; Holliday junction nuclease RuvC; Holliday junction resolvase RuvC
AA Sequence

AIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVFEYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITHCHVSQNAMQMSESRLNLARGRLR

Molecular Weight

Approximately 34.6 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

RuvC Protein, E.coli (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
RuvC Protein, E.coli (His-SUMO)
Cat. No.:
HY-P71514
Quantity:
MCE Japan Authorized Agent: