1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TNF-β
  6. TNF-beta/TNFSF1 Protein, Human

TNF-β (tumor necrosis factor β) also called lymphotoxin-α (LT-α), a member of the tumor necrosis factor superfamily, is a cytokine produced by lymphocytes. TNF-β activates the NF-κB signaling pathway, inducing cancer cell proliferation, invasion. TNF-β up-regulates genes connected with metastasis, promotes epithelial-to-mesenchymal-transition, stimulates its own expression. TNF-β mediates a large variety of inflammatory, immunostimulatory, and antiviral responses. TNF-beta/TNFSF1 Protein, Human is a recombinant protein consisting of 158 amino acids (L35-L205) and is produced in E. coli.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

TNF-β (tumor necrosis factor β) also called lymphotoxin-α (LT-α), a member of the tumor necrosis factor superfamily, is a cytokine produced by lymphocytes. TNF-β activates the NF-κB signaling pathway, inducing cancer cell proliferation, invasion[1][2]. TNF-β up-regulates genes connected with metastasis, promotes epithelial-to-mesenchymal-transition, stimulates its own expression[3]. TNF-β mediates a large variety of inflammatory, immunostimulatory, and antiviral responses. TNF-beta/TNFSF1 Protein, Human is a recombinant protein consisting of 158 amino acids (L35-L205) and is produced in E. coli.

Background

TNF-β is expressed by a variety of cells, including T cells, B cells and natural killer (NK) cells[1].
The amino acid sequence of human TNF beta protein has low homology between mouse and rat TNF alpha protein. While, rat TNF alpha shares 95.54% aa sequence identity with mouse TNF alpha protein.
TNF-β can be secreted and binds with high affinity to TNF receptors 1 and 2 (TNFR-1 and TNFR-2), and it is transiently expressed on the cell surfaces of activated B and T cells, where it forms a complex with LT-β as an LTα1β2 heterotrimer, activates NF-kB, MAPK, and PI3K/AKT pathways and induces cancer cells proliferation, invasion[1].
TNF-β is translated as a 25 kDa glycosylated polypeptide with 171 amino acid residues. TNF-β up-regulates of NF-κB signaling and activates of pro-inflammatory activity[1].TNF-β induces tumor cells proliferation, migration and increases the expression of p-p65, p-IkBα in a dose dependent manner[2].

In Vitro

TNF-β (human) (1, 10 ng/mL; 12 h; primary human chondrocytes) induces TNF-β and TNF-β-R expression on surface of chondrocytes and enhances adhesiveness to T lymphocytes when cocultured with T lymphocytes (Jurkat cells) for 4 h[1].
TNF-β (human) (1, 5, 10 ng/mL; 24 h) markedly stimulates HCT116 proliferation and migration in a dose dependent manner, and increases the expression of p-p65, p-IkBα in HCT116 cells in a dose dependent manner[2].

Biological Activity

The ED50 is <80 pg/mL as measured by L-929 mouse fibrosarcoma cells in the presence of the metabolic inhibitor actinomycin D, corresponding to a specific activity of >1.25 × 107 units/mg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P01374 (L35-L205)

Gene ID
Molecular Construction
N-term
TNF-β (L35-L205)
Accession # P01374
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuTNF-β; TNF-β; TNFSF1; Lymphotoxin-alpha
AA Sequence

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Molecular Weight

16-19 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

TNF-beta/TNFSF1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TNF-beta/TNFSF1 Protein, Human
Cat. No.:
HY-P7304
Quantity:
MCE Japan Authorized Agent: