1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLBD2 Protein, Rat (His-SUMO)

The PLBD2 protein is a putative phospholipase that may participate in cellular processes by interacting with IGF2R. Although the function and mechanism of the enzyme are unclear, its association with IGF2R suggests involvement in the insulin-like growth factor 2 receptor-related signaling pathway. PLBD2 Protein, Rat (His-SUMO) is the recombinant rat-derived PLBD2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PLBD2 protein is a putative phospholipase that may participate in cellular processes by interacting with IGF2R. Although the function and mechanism of the enzyme are unclear, its association with IGF2R suggests involvement in the insulin-like growth factor 2 receptor-related signaling pathway. PLBD2 Protein, Rat (His-SUMO) is the recombinant rat-derived PLBD2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

PLBD2 Protein, identified as a putative phospholipase, exhibits a potential role in cellular processes by interacting with IGF2R. While the specific enzymatic functions and detailed mechanisms of PLBD2 remain to be fully elucidated, its interaction with IGF2R suggests a potential involvement in cellular signaling pathways related to insulin-like growth factor 2 receptor-mediated processes. The precise contribution of PLBD2 in cellular homeostasis, phospholipid metabolism, or other regulatory pathways warrants further investigation. The interaction with IGF2R adds a layer of complexity to PLBD2's potential functions, suggesting a connection to cellular pathways associated with growth and development. Further studies are needed to unravel the intricate role of PLBD2 in cellular physiology and its functional implications in cellular signaling cascades.

Species

Rat

Source

E. coli

Tag

N-His;N-SUMO

Accession

Q4QQW8 (G36-D585)

Gene ID
Molecular Construction
N-term
6*His-SUMO
PLBD2 (G36-D585)
Accession # Q4QQW8
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Plbd2; RDCR-0918-3; Putative phospholipase B-like 2; EC 3.1.1.-; LAMA-like protein 2; Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2
AA Sequence

GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD

Predicted Molecular Mass
77.9 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PLBD2 Protein, Rat (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLBD2 Protein, Rat (His-SUMO)
Cat. No.:
HY-P71557
Quantity:
MCE Japan Authorized Agent: