1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. NNT1/CLC Protein, Human (HEK293, Fc)

NNT1/CLC protein binds to CRLF1 to form an important neurotropic cytokine related to neuronal development. In addition, it stimulates B cells and upon binding activates the ILST/gp130 receptor. NNT1/CLC Protein, Human (HEK293, Fc) is the recombinant human-derived NNT1/CLC protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
2 μg Ask For Quote & Lead Time
10 μg Ask For Quote & Lead Time
50 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NNT1/CLC protein binds to CRLF1 to form an important neurotropic cytokine related to neuronal development. In addition, it stimulates B cells and upon binding activates the ILST/gp130 receptor. NNT1/CLC Protein, Human (HEK293, Fc) is the recombinant human-derived NNT1/CLC protein, expressed by HEK293 , with N-hFc labeled tag.

Background

In conjunction with CRLF1, the NNT1/CLC protein forms a heterodimeric neurotropic cytokine, likely playing a crucial role in neuronal development. Additionally, NNT1/CLC stimulates B-cells and binds to, activating the ILST/gp130 receptor. It forms a heteromeric complex with the cardiotrophin-like cytokine CRLF1/CLF-1, and this CRLF1-CLCF1 complex serves as a ligand for the ciliary neurotrophic factor receptor/CNTFR. Notably, both the CRLF1-CLCF1 heterodimer and the tripartite signaling complex, composed of CRLF1, CLCF1, and CNTFR, bind to SORL1, with the interaction predominantly mediated by the CRLF1 moiety within the complex. These intricate associations underscore the diverse functions of NNT1/CLC protein in neurodevelopmental processes and immune regulation.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

Q9UBD9/ NP_037378.1 (L28-F225)

Gene ID
Molecular Construction
N-term
hFc
NP_037378.1 NNT1/CLC (L28-F225)
Accession # Q9UBD9/
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Cardiotrophin-like cytokine factor 1; BSF-3; CLCF1; BSF3; CLC; NNT1
AA Sequence

LNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGTYLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGLNRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQKMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF

Molecular Weight

Approximately 53 kDa

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NNT1/CLC Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NNT1/CLC Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75942
Quantity:
MCE Japan Authorized Agent: