1. Recombinant Proteins
  2. MMP13 Protein, Human (His-SUMO)

The MMP-13 protein plays a role in the degradation of extracellular matrix proteins, especially fibrillar collagen, fibronectin, TNC, and ACAN. It cleaves triple-helical collagen, preferentially cleaves type II collagen, and can also target other collagen types. MMP13 Protein, Human (His-SUMO) is the recombinant human-derived MMP13 protein, expressed by E. coli, with N-6*His and N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The MMP-13 protein plays a role in the degradation of extracellular matrix proteins, especially fibrillar collagen, fibronectin, TNC, and ACAN. It cleaves triple-helical collagen, preferentially cleaves type II collagen, and can also target other collagen types. MMP13 Protein, Human (His-SUMO) is the recombinant human-derived MMP13 protein, expressed by E. coli, with N-6*His and N-SUMO labeled tag.

Background

MMP-13 (Matrix Metalloproteinase 13) emerges as a pivotal player in extracellular matrix modulation, wielding its influence over various proteins such as fibrillar collagen, fibronectin, TNC, and ACAN. It exhibits notable proficiency in cleaving triple helical collagens, particularly type I, type II, and type III, with the highest activity observed with soluble type II collagen. MMP-13's multifaceted role extends beyond matrix degradation; it may also act on key regulatory proteins, including TGFB1 and CCN2, thereby influencing processes such as wound healing, tissue remodeling, cartilage degradation, and bone development. Its indispensability in embryonic bone development and ossification underscores its significance, while its involvement in fracture healing through endochondral ossification highlights its dynamic contributions to physiological processes. Moreover, MMP-13 plays a role in keratinocyte migration during wound healing and is implicated in cell migration and tumor invasion, reflecting its diverse impact on cellular functions.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P45452 (Y104-C471)

Gene ID

4322

Molecular Construction
N-term
6*His
SUMO
MMP13 (Y104-C471)
Accession # P45452
C-term
Protein Length

Full Length of Mature Protein

Synonyms
MMP13; Collagenase 3; Matrix metalloproteinase-13; MMP-13
AA Sequence

YNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC

Predicted Molecular Mass
58.3 kDa
Molecular Weight

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Monomer
Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP13 Protein, Human (His-SUMO)
Cat. No.:
HY-P704804
Quantity:
MCE Japan Authorized Agent: