1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. MDK/Midkine Protein, Human (His-Avi)

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Midkine (MDK) protein is a multifunctional cytokine and growth factor that signals through cell surface proteoglycan and non-proteoglycan receptors. MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration and plays a crucial role in inflammation by recruiting neutrophils and macrophages. MDK/Midkine Protein, Human (His-Avi) is the recombinant human-derived MDK/Midkine protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Background

Midkine (MDK) is a secreted protein that serves as a multifunctional cytokine and growth factor, transmitting signals through cell-surface proteoglycan and non-proteoglycan receptors. Engaging in various physiological processes, MDK regulates inflammatory responses, cell proliferation, adhesion, growth, survival, tissue regeneration, differentiation, and migration. It plays a crucial role in inflammatory processes by mediating the recruitment of neutrophils and macrophages to inflammation sites, exhibiting dual activities that include promoting epithelial cell survival and facilitating smooth muscle cell migration following renal and vessel damage. Moreover, MDK suppresses the development of tolerogenic dendritic cells, inhibiting regulatory T cell differentiation and promoting T cell expansion through NFAT signaling and Th1 cell differentiation. MDK's involvement extends to tissue regeneration, contributing to heart damage recovery by negatively regulating inflammatory cell recruitment and mediating cell survival through MAPKs and AKT pathways, along with facilitating liver regeneration, bone repair, and brain development. Interactions with various receptors, such as PTPRZ1, ITGA4:ITGB1 complex, LRP1, and GPC2, underscore MDK's intricate regulatory role in diverse physiological processes.

Biological Activity

Measured by its ability to chemoattract macrophages cells. The ED50 for this effect is 6.419 ng/mL, corresponding to a specific activity is1.558×105 U/mg.

  • Measured by its ability to chemoattract macrophages cells. The ED50 for this effect is 6.419 ng/mL, corresponding to a specific activity is1.558×105 U/mg.
Species

Human

Source

E. coli

Tag

N-His;N-Avi

Accession

P21741-1 (V21-D143)

Gene ID
Molecular Construction
N-term
His-Avi
MDK (V21-D143)
Accession # P21741-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
MK; ARAP; MDK; MEK; MK1; MKARAP; NEGF2
AA Sequence

VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD

Molecular Weight

Approximately 16.46-18 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MDK/Midkine Protein, Human (His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MDK/Midkine Protein, Human (His-Avi)
Cat. No.:
HY-P700791
Quantity:
MCE Japan Authorized Agent: