LASB Protein, Pseudomonas aeruginosa (P. pastoris, His)

LASB proteins are multifunctional enzymes that exhibit broad substrate specificity by cleaving host elastin, collagen, IgG, multiple complement components, and endogenous proaminopeptidases. Furthermore, LASB exhibits autocatalytic activity in processing its own propeptide and plays a role in processing the propeptide of chitin-binding protein (cbpD). LASB Protein, Pseudomonas aeruginosa (P. pastoris, His) is the recombinant LASB protein, expressed by P. pastoris , with N-6*His labeled tag.

LASB (LasA) protein, identified as a virulence factor in Pseudomonas aeruginosa, plays a significant role in the pathogenesis of infections. This calcium-dependent metalloprotease exhibits a broad substrate specificity, cleaving host elastin, collagen, IgG, and various complement components, along with endogenous pro-aminopeptidase. LASB engages in autocatalytic processing of its pro-peptide and also processes the pro-peptide of pro-chitin-binding protein (cbpD). These enzymatic activities contribute to the bacterium's virulence by facilitating tissue damage and immune evasion. The diverse substrate specificity and autocatalytic processing underscore LASB's multifaceted role in the pathogenicity of P. aeruginosa.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Others

P. pastoris

N-6*His

P14756 (A198-L498)

880368  [NCBI]

Full Length of Mature Protein

AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL

68 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.