1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. LASB Protein, Pseudomonas aeruginosa (P. pastoris, His)

LASB Protein, Pseudomonas aeruginosa (P. pastoris, His)

Cat. No.: HY-P700628
Handling Instructions Technical Support

LASB proteins are multifunctional enzymes that exhibit broad substrate specificity by cleaving host elastin, collagen, IgG, multiple complement components, and endogenous proaminopeptidases. Furthermore, LASB exhibits autocatalytic activity in processing its own propeptide and plays a role in processing the propeptide of chitin-binding protein (cbpD). LASB Protein, Pseudomonas aeruginosa (P. pastoris, His) is the recombinant LASB protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LASB proteins are multifunctional enzymes that exhibit broad substrate specificity by cleaving host elastin, collagen, IgG, multiple complement components, and endogenous proaminopeptidases. Furthermore, LASB exhibits autocatalytic activity in processing its own propeptide and plays a role in processing the propeptide of chitin-binding protein (cbpD). LASB Protein, Pseudomonas aeruginosa (P. pastoris, His) is the recombinant LASB protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

LASB (LasA) protein, identified as a virulence factor in Pseudomonas aeruginosa, plays a significant role in the pathogenesis of infections. This calcium-dependent metalloprotease exhibits a broad substrate specificity, cleaving host elastin, collagen, IgG, and various complement components, along with endogenous pro-aminopeptidase. LASB engages in autocatalytic processing of its pro-peptide and also processes the pro-peptide of pro-chitin-binding protein (cbpD). These enzymatic activities contribute to the bacterium's virulence by facilitating tissue damage and immune evasion. The diverse substrate specificity and autocatalytic processing underscore LASB's multifaceted role in the pathogenicity of P. aeruginosa.

Species

Others

Source

P. pastoris

Tag

N-6*His

Accession

P14756 (A198-L498)

Gene ID

880368  [NCBI]

Molecular Construction
N-term
6*His
LASB (A198-L498)
Accession # P14756
C-term
Synonyms
lasB; Neutral metalloproteinase PAE Pseudolysin Cleaved into the following chain: Pro-elastase;
AA Sequence

AEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL

Molecular Weight

35.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LASB Protein, Pseudomonas aeruginosa (P. pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LASB Protein, Pseudomonas aeruginosa (P. pastoris, His)
Cat. No.:
HY-P700628
Quantity:
MCE Japan Authorized Agent: