KGF-2/FGF-10 Protein, Human (169a.a)

KGF-2/FGF-10 belongs to the fibroblast growth factor family and is a heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 regulates epithelial cell function by binding to the FGFR2-IIIb/FGFR1-IIIb receptors of epithelial cells. KGF-2/FGF-10 can be used in the study of tissue repair and prevention of fibrosis in diseases such as lung injury and corneal alkali burns^[2][3]. KGF-2/FGF-10 Protein, Human (169a.a) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E.coli, with tag-free.

KGF-2/FGF-10 (keratinocyte growth factor-2) belongs to the fibroblast growth factor family (FGF family) and is a 20 kD heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 mainly acts on epithelial cells, and its receptors are FGFR2-IIIb and FGFR1-IIIb (IIIb subtype of fibroblast growth factor receptor 2/1) expressed by epithelial cells. Its function is mainly mediated by the FGF-2 IIIb receptor, which is a transmembrane receptor expressed only by epithelial cells^[1]. KGF-2 promotes the growth, proliferation and differentiation of epithelial cells and has a good effect in treating epithelial damage. KGF-2 can enhance corneal wound healing in a rabbit model of carbon dioxide laser-induced corneal injury. KGF-2/FGF-10 regulates epithelial cell proliferation, migration and differentiation by binding to FGFR2-IIIb/FGFR1-IIIb receptors, and participates in tissue repair and inflammation regulation. KGF-2/FGF-10 is induced by inflammatory factors (such as TNF-α and IL-1β) upstream, and promotes cell adhesion downstream through integrins (such as VLA-4)^[2][3]. KGF-2/FGF-10 participates in AMPK, PI3K-mTOR, MAPK/ERK and p38 pathways. In the AMPK pathway, KGF-2/FGF-10 activates AMPK in lung injury, inhibits NLRP3 inflammasome and pyroptosis (GSDMD/IL-1β)^[2]; in the PI3K-mTOR pathway, KGF-2/FGF-10 promotes alveolar type II cell autophagy (such as increased LC3II and decreased p62)^[2]; in the MAPK/ERK and p38 pathways, KGF-2/FGF-10 activates ERK1/2 and p38 in corneal repair, promotes fibroblast migration, and inhibits TGF-β1-induced α-SMA expression and myofibroblast differentiation^[3].
KGF-2/FGF-10 can be used in the research of lung diseases, corneal repair, and the prevention and treatment of tissue fibrosis. In the ventilator-induced lung injury (VILI) model, KGF-2/FGF-10 alleviates pulmonary edema by protecting the alveolar-capillary barrier, reducing the release of inflammatory factors (TNF-α, MIP-2), and increasing the expression of surfactant proteins (SP-A/B/C)^[2]. KGF-2/FGF-10 accelerates epithelial healing and inhibited scar formation (reduced α-SMA and myofibroblasts) in the corneal alkali burn model, with a better effect than bFGF^[3]. KGF-2/FGF-10 also inhibits the differentiation of myofibroblasts and reduces the expression of fibrosis-related proteins^[3].

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ for this effect is ≤84.07 ng/mL, corresponding to a specificactivity is ≥1.2×10⁴ Unit/mg.

• 
  Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED₅₀ for this effect is 35.64 ng/mL, corresponding to a specificactivity is 2.806×10⁴ Unit/mg.

Human

E. coli

Tag Free

O15520 (L40-S208)

2255  [NCBI]

Full Length of Mature Protein

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Approximately 19-22 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4 or 10 mM Tris, 5% Sucrose, 4% Mannitol, 0.02% Tween 80, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCL, pH 7.4 or PBS , pH 7.4, 5-8 % trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Cai J, et al. Pharmacokinetics of topically applied recombinant human keratinocyte growth factor-2 in alkali-burned and intact rabbit eye. Exp Eye Res. 2015 Jul;136:93-9.  [Content Brief]

  [2]. Bi J, et al. Keratinocyte growth factor-2 intratracheal instillation significantly attenuates ventilator-induced lung injury in rats. J Cell Mol Med. 2014 Jun;18(6):1226-35.  [Content Brief]

  [3]. Cai J, et al. Comparative Analysis of KGF-2 and bFGF in Prevention of Excessive Wound Healing and Scar Formation in a Corneal Alkali Burn Model. Cornea. 2019 Nov;38(11):1430-1437.  [Content Brief]