1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-10
  6. KGF-2/FGF-10 Protein, Human (169a.a)

KGF-2/FGF-10 belongs to the fibroblast growth factor family and is a heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 regulates epithelial cell function by binding to the FGFR2-IIIb/FGFR1-IIIb receptors of epithelial cells. KGF-2/FGF-10 can be used in the study of tissue repair and prevention of fibrosis in diseases such as lung injury and corneal alkali burns. KGF-2/FGF-10 Protein, Human (169a.a) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E.coli, with tag-free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

KGF-2/FGF-10 belongs to the fibroblast growth factor family and is a heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 regulates epithelial cell function by binding to the FGFR2-IIIb/FGFR1-IIIb receptors of epithelial cells. KGF-2/FGF-10 can be used in the study of tissue repair and prevention of fibrosis in diseases such as lung injury and corneal alkali burns[2][3]. KGF-2/FGF-10 Protein, Human (169a.a) is the recombinant human-derived KGF-2/FGF-10 protein, expressed by E.coli, with tag-free.

Background

KGF-2/FGF-10 (keratinocyte growth factor-2) belongs to the fibroblast growth factor family (FGF family) and is a 20 kD heparin-binding protein secreted by mesenchymal cells. KGF-2/FGF-10 mainly acts on epithelial cells, and its receptors are FGFR2-IIIb and FGFR1-IIIb (IIIb subtype of fibroblast growth factor receptor 2/1) expressed by epithelial cells. Its function is mainly mediated by the FGF-2 IIIb receptor, which is a transmembrane receptor expressed only by epithelial cells[1]. KGF-2 promotes the growth, proliferation and differentiation of epithelial cells and has a good effect in treating epithelial damage. KGF-2 can enhance corneal wound healing in a rabbit model of carbon dioxide laser-induced corneal injury. KGF-2/FGF-10 regulates epithelial cell proliferation, migration and differentiation by binding to FGFR2-IIIb/FGFR1-IIIb receptors, and participates in tissue repair and inflammation regulation. KGF-2/FGF-10 is induced by inflammatory factors (such as TNF-α and IL-1β) upstream, and promotes cell adhesion downstream through integrins (such as VLA-4)[2][3]. KGF-2/FGF-10 participates in AMPK, PI3K-mTOR, MAPK/ERK and p38 pathways. In the AMPK pathway, KGF-2/FGF-10 activates AMPK in lung injury, inhibits NLRP3 inflammasome and pyroptosis (GSDMD/IL-1β)[2]; in the PI3K-mTOR pathway, KGF-2/FGF-10 promotes alveolar type II cell autophagy (such as increased LC3II and decreased p62)[2]; in the MAPK/ERK and p38 pathways, KGF-2/FGF-10 activates ERK1/2 and p38 in corneal repair, promotes fibroblast migration, and inhibits TGF-β1-induced α-SMA expression and myofibroblast differentiation[3].
KGF-2/FGF-10 can be used in the research of lung diseases, corneal repair, and the prevention and treatment of tissue fibrosis. In the ventilator-induced lung injury (VILI) model, KGF-2/FGF-10 alleviates pulmonary edema by protecting the alveolar-capillary barrier, reducing the release of inflammatory factors (TNF-α, MIP-2), and increasing the expression of surfactant proteins (SP-A/B/C)[2]. KGF-2/FGF-10 accelerates epithelial healing and inhibited scar formation (reduced α-SMA and myofibroblasts) in the corneal alkali burn model, with a better effect than bFGF[3]. KGF-2/FGF-10 also inhibits the differentiation of myofibroblasts and reduces the expression of fibrosis-related proteins[3].

In Vitro

In the proliferation assay of rabbit corneal fibroblasts (RCFs), KGF-2/FGF-10 (human; 50 mg/mL; 48 h) promotes cell proliferation in a dose-dependent manner, and its effect could be blocked by the ERK1/2 inhibitor PD98059[3].
In the RCF scratch migration assay, KGF-2/FGF-10 (human; 50 mg/mL; 24 h) significantly promotes cell migration, with a stronger effect than bFGF, and the migration is dependent on the p38 and ERK1/2 signaling pathways. The p38 inhibitor SB203580 or the ERK1/2 inhibitor PD98059 could partially inhibit this effect[3].
KGF-2/FGF-10 (human; 50 mg/mL) significantly inhibits α-SMA expression and myofibroblast differentiation in TGF-β1-induced RCF differentiation experiments, and the effect is better than bFGF[3].

In Vivo

KGF-2/FGF-10 (human; 5 mg/kg; 72 h after administration, intratracheal instillation; single dose) significantly improves pulmonary edema, reduces the levels of inflammatory factors (TNF-α, MIP-2) in bronchoalveolar lavage fluid, increases the number of alveolar type II cells and the mRNA expression of lung surfactant proteins (SP-A, SP-B, SP-C), and alleviates lung tissue pathological damage in the rat ventilator-induced lung injury (VILI) model[3].
KGF-2/FGF-10 (human; 50 mg/mL; topical eye drops; 3 times/day; 14 days) accelerates corneal epithelial healing (wound closure within 7 days), reduces α-SMA expression and myofibroblast differentiation, and reduces corneal thickness and scar formation in the rat corneal alkali burn model, with better effects than bFGF[3].

Biological Activity

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is ≤84.07 ng/mL, corresponding to a specificactivity is ≥1.2×104 Unit/mg.

  • Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 35.64 ng/mL, corresponding to a specificactivity is 2.806×104 Unit/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

O15520 (L40-S208)

Gene ID
Molecular Construction
N-term
FGF-10 (L40-S208)
Accession # O15520
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuKGF-2/FGF-10; Fibroblast Growth Factor-10
AA Sequence

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Molecular Weight

Approximately 19-22 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4 or 10 mM Tris, 5% Sucrose, 4% Mannitol, 0.02% Tween 80, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCL, pH 7.4 or PBS , pH 7.4, 5-8 % trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

KGF-2/FGF-10 Protein, Human (169a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KGF-2/FGF-10 Protein, Human (169a.a)
Cat. No.:
HY-P7048
Quantity:
MCE Japan Authorized Agent: