1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Activin/Inhibins
  5. Inhibin B
  6. INHBE Protein, Human (HEK293, Fc)

The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth. INHBE Protein, Human (HEK293, Fc) is the recombinant human-derived INHBE protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The INHBE protein is an important molecular switch that coordinates the inhibin and activin systems to regulate pituitary follicle-stimulating hormone secretion. Its critical role extends to multiple physiological functions, including hormone secretion, cell development, insulin release, and bone growth. INHBE Protein, Human (HEK293, Fc) is the recombinant human-derived INHBE protein, expressed by HEK293 , with N-hFc labeled tag.

Background

INHBE protein assumes a pivotal role in the intricate orchestration of the inhibin and activin systems, serving as a molecular switch to either inhibit or activate the secretion of follitropin by the pituitary gland. Within the broader context, inhibins and activins, and by extension, INHBE, contribute to the regulation of a myriad of physiological functions spanning hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development, and bone growth. The dynamic interplay between inhibins and activins is underscored by their opposing functions, where inhibins, typified by heterodimeric structures like Inhibin A and Inhibin B, counteract the actions of activins. Structurally, INHBE exists in homodimeric or heterodimeric configurations through its association with alpha and beta subunits, intricately linked by one or more disulfide bonds. Notably, inhibins present as heterodimers comprising one alpha and one beta subunit, while activins, whether in homodimeric or heterodimeric form, exclusively consist of beta subunits, exemplifying the nuanced and versatile regulatory roles played by INHBE in shaping diverse physiological responses.

Species

Human

Source

HEK293

Tag

N-hFc

Accession

P58166 (T237-S350)

Gene ID
Molecular Construction
N-term
hFc
INHBE (T237-S350)
Accession # P58166
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Inhibin beta E chain; Activin beta-E chain; INHBE
AA Sequence

TPTCEPATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGCS

Predicted Molecular Mass
40.9 kDa
Molecular Weight

Approximately 43 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4, 5% trehalose, 5%mannitol, 0.01% tween-80 or 20 mM PB, 150 mM NaCl, pH 7.4 or PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

INHBE Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
INHBE Protein, Human (HEK293, Fc)
Cat. No.:
HY-P75888
Quantity:
MCE Japan Authorized Agent: