1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Interleukin & Receptors Cytokine Receptors
  4. IL-10 Receptor
  5. IL-10R beta
  6. IL-10R beta Protein, Mouse (HEK293, His)

IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses. IL-10R beta Protein, Mouse (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (W223-Y251) with a His tag at the C-terminus.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-10R beta protein is an IL10 cytokine surface receptor involved in IL10-mediated inflammation and immune regulation, as well as viral defense responses. IL-10R beta Protein, Mouse (HEK293, His) is expressed by HEK 293 cells and has a transmembrane region (W223-Y251) with a His tag at the C-terminus[3].

Background

IL-10 receptor complex consists of a heterodimer of four transmembrane chains, two of which form IL-10R alpha and two of which form IL-10R beta. IL-10R beta, originally known as the orphan receptor CRF2-4, is an essential accessory subunit for the active interleukin 10 receptor complex[1].
IL-10R beta can bind to IL-10 via the JAK-STAT pathway, and activation of the IL-10 receptor complex leads to phosphorylation of the receptor-associated proteins TYK and JAK-1, and ultimately to activation of the transcription factors STAT3, STAT1, and STAT5, which regulate the expression of IL-10-responsive genes, including c-myc, bcl-2, and bcl-xL, initiating signal transduction[2].
IL-10R beta is expressed on most cell types and is also a shared cell surface receptor required for the activation of five class II cytokines (IL-10, IL-22, IL-26, IL-28 and IFNL1), which play a key role in host defense, immune regulation. Among them, the IFNLR1/IL10R beta dimer is the receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity[3].

In Vitro

Increasing IL-1R beta levels but not IL-22Rα levels in HEK293T cells is sufficient to reduce the degree of STAT3 bias induced by IL-22 variant 22-B3. It is shown that different STAT1/3 activation thresholds downstream of IL-22 can be regulated by IL-1R beta affinity as well as IL-1R beta expression, resulting in tissue-selective agonism of individual IL-22 receptor ligands[4].

In Vivo

Transfer of CD4 T cells from IL-1R beta -/- mice into CCR9-/- mice can not induce cells producing ovalbumin (via oral administration)-specific IL-1, suggesting that intestine-homing CD4 T cells need to be exposed to IL-1 signaling in the intestine to become fully tolerant to IL-1 in the oral immunological tolerance (OT)[5].
IL-1R beta expression is closely correlated with IL-22 variant 22-B3 signaling intensity, and IL-1R beta expression is highest in the pancreas, followed by the colon, skin, and then the liver in C57BL/6J mice, suggesting that IL-1R beta expression levels are a major determinant of the type of STAT signaling induced by some IL-22 agonists[4].

Biological Activity

Measured by its binding ability in a functional ELISA. When Mouse IL-10 R alpha is present at 1 µg/mL can bind Mouse IL-10 R beta in the presence of 1 µg/mL Mouse IL-10. The ED50 for this effect is 1.098 μg/mL.

  • Measured by its binding ability in a functional ELISA. When Mouse IL-10 R alpha is present at 1 µg/mL can bind Mouse IL-10 R beta in the presence of 1 µg/mL Mouse IL-10. The ED50 for this effect is 1.098 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8VHM7 (M22-S222)

Gene ID
Molecular Construction
N-term
IL-10Rβ (M22-S222)
Accession # Q8VHM7
His
C-term
Protein Length

Partial

Synonyms
Interleukin-10 receptor subunit beta; IL-10RB; CRF2-4; IL-10R2; CDw210b
AA Sequence

MIPPPEKVRMNSVNFKNILQWEVPAFPKTNLTFTAQYESYRSFQDHCKRTASTQCDFSHLSKYGDYTVRVRAELADEHSEWVNVTFCPVEDTIIGPPEMQIESLAESLHLRFSAPQIENEPETWTLKNIYDSWAYRVQYWKNGTNEKFQVVSPYDSEVLRNLEPWTTYCIQVQGFLLDQNRTGEWSEPICERTGNDEITPS

Molecular Weight

35-45 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-10R beta Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74837
Quantity:
MCE Japan Authorized Agent: