1. Recombinant Proteins
  2. CD Antigens Fc Receptors
  3. B Cell CD Proteins Fc Receptor-like Proteins
  4. CD307a/FCRL1 Fc Receptor Like 1 (FCRL1)
  5. FCRL1 Protein, Mouse (203a.a, HEK293, His)

Fc receptor-like protein 1 (Fcrl1) is a cell-surface membrane protein that belongs to FCRL family. Fcrl1 is a BCR co-receptor and enhance signaling through the B cell receptor. Fcrl1 promotes B cell proliferation and calcium mobilization. Fcrl1 is a biomarker and an important target in B cell lymphoproliferative disorders. FCRL1 Protein, Mouse (203a.a, HEK293, His) is the recombinant mouse-derived FCRL1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc receptor-like protein 1 (Fcrl1) is a cell-surface membrane protein that belongs to FCRL family. Fcrl1 is a BCR co-receptor and enhance signaling through the B cell receptor. Fcrl1 promotes B cell proliferation and calcium mobilization. Fcrl1 is a biomarker and an important target in B cell lymphoproliferative disorders[1][2][3]. FCRL1 Protein, Mouse (203a.a, HEK293, His) is the recombinant mouse-derived FCRL1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Fc receptor-like protein 1 (Fcrl1), a cell-surface membrane protein, belongs to FCRL family, and is preferentially expressed on B cells. Fcrl1, a BCR co-receptor, is an activating receptor which can enhance signaling through the B cell receptor. Fcrl1 promotes B cell proliferation and calcium mobilization[1]. Fcrl1 is a biomarker and an important therapeutic target in B cell lymphoproliferative disorders[2][3].

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

A0A0R4J0W8/BAC30017.1 (A17-S219)

Gene ID
Molecular Construction
N-term
FCRL1 (A17-S219)
Accession # A0A0R4J0W8/BAC30017.1
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
Fc receptor-like protein 1; FcRL1; FcRH1; hIFGP1; CD307a; FCRH1; IFGP1; IRTA5
AA Sequence

AGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIPSELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLS

Molecular Weight

Approximately 40-54 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

FCRL1 Protein, Mouse (203a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FCRL1 Protein, Mouse (203a.a, HEK293, His)
Cat. No.:
HY-P72656
Quantity:
MCE Japan Authorized Agent: