1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Erythropoietin Protein, Cynomolgus (His-SUMO)

Erythropoietin Protein, Cynomolgus (His-SUMO)

Cat. No.: HY-P72186
Handling Instructions Technical Support

Erythropoietin protein (EPO) regulates erythrocyte growth and balance. EPO binding to its receptor (EPOR) triggers EPOR dimerization, activating JAK2. This initiates downstream events involving effectors like STAT1 and STAT3, crucial for erythrocyte proliferation, differentiation, and maintaining optimal blood cell levels. Erythropoietin Protein, Cynomolgus (His-SUMO) is the recombinant cynomolgus-derived Erythropoietin protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Erythropoietin protein (EPO) regulates erythrocyte growth and balance. EPO binding to its receptor (EPOR) triggers EPOR dimerization, activating JAK2. This initiates downstream events involving effectors like STAT1 and STAT3, crucial for erythrocyte proliferation, differentiation, and maintaining optimal blood cell levels. Erythropoietin Protein, Cynomolgus (His-SUMO) is the recombinant cynomolgus-derived Erythropoietin protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

Erythropoietin protein (EPO) plays a crucial role in regulating the growth and maturation of red blood cells, as well as maintaining the appropriate balance of circulating erythrocytes in the body. When EPO binds to its receptor (EPOR), it triggers EPOR dimerization, which in turn activates JAK2, initiating a cascade of events that involve specific downstream effectors such as STAT1 and STAT3. These molecular pathways are essential for ensuring the proper proliferation and differentiation of erythrocytes, as well as maintaining the optimal level of red blood cells in circulation.

Species

Cynomolgus

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

P07865 (A28-R192)

Gene ID
Molecular Construction
N-term
6*His-SUMO
Erythropoietin (A28-R192)
Accession # P07865
C-term
Protein Length

Full Length of Mature Protein

Synonyms
EPOErythropoietin
AA Sequence

APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR

Molecular Weight

Approximately 34.2 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Erythropoietin Protein, Cynomolgus (His-SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Erythropoietin Protein, Cynomolgus (His-SUMO)
Cat. No.:
HY-P72186
Quantity:
MCE Japan Authorized Agent: