EphA10 Protein, Mouse (HEK293, His)

EphA10, a receptor for ephrin-A family members, selectively binds EFNA3, EFNA4, and EFNA5, indicating its involvement in mediating cellular responses to ephrin-A ligands and participating in diverse cellular processes regulated by Eph-ephrin signaling pathways. EphA10 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EphA10 protein, expressed by HEK293 , with C-His labeled tag.

EphA10, identified as a receptor for members of the ephrin-A family, plays a crucial role in cellular signaling. Specifically, it acts as a receptor for ephrin ligands EFNA3, EFNA4, and EFNA5. The interaction between EphA10 and these ephrin-A family members suggests its involvement in diverse cellular processes, likely including cell-cell communication and regulation of tissue development. This receptor-ligand binding capacity highlights EphA10's significance in mediating signaling events that contribute to various physiological and developmental processes.

Measured by its binding ability in a functional ELISA. When Mouse Ephrin-A3 is coated at 5 μg/mL (100 μL/well) can bind Mouse EPHA10. The ED₅₀ for this effect is 0.1148 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Mouse Ephrin-A3 is coated at 5 μg/mL (100 μL/well) can bind Mouse EPHA10. The ED₅₀ for this effect is 0.1148 μg/mL.

Mouse

HEK293

C-His

Q8BYG9-1 (L23-A565)

230735  [NCBI]

Extracellular Domain

LLLGPGRPGTAEEVILLDSKASQAELGWTALPSTGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGATGTCKETFNAYYLETETDLGRGRPRLGGNRPRKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRQGFHLAFQDVGACVALVSVRVYYKQCRATVRGLAAFPATAAESAFSTLVEVAGTCVAHSEGEPSSPPRMHCGADGEWLVPVGRCSCSAGFQEHGDICEACPPGFYKVSPRRPLCSPCPEHSLALENASTFCVCQDTYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWLPPADSGGRSDVTYSLLCLRCGRDGPAGACQPCGPRVAFVPRQAGLRERAATLLHLRPGARYTVRVAALNGVSGPAAAAGATYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPVPAGAPGTNSTEYEIRYYEKGQSEQTYSTVKTGAPAVTVTNLKPATRYVFQIRAASPGPLWEAQSFSPSIEVQTPGEVAPGSRDQSPA

Approximately 60-80 kDa, due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22μm filtered solution in PBS, pH 7.4, 8% trehalose or PBS, pH 8.0, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.