1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Stimulatory Immune Checkpoint Molecules NK Cell CD Proteins Platelet CD Proteins
  4. DNAM-1/CD226 DNAM-1/CD226
  5. DNAM-1 Protein, Mouse (HEK293, His)

DNAM-1 Protein, a cell surface receptor, mediates intercellular adhesion, signaling, cytotoxicity, and lymphokine secretion in CTL and NK cells. It acts as a receptor for NECTIN2, stimulating T-cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG). DNAM-1 Protein competes with PVRIG for NECTIN2-binding and interacts with PVR and NECTIN2. DNAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DNAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DNAM-1 Protein, a cell surface receptor, mediates intercellular adhesion, signaling, cytotoxicity, and lymphokine secretion in CTL and NK cells. It acts as a receptor for NECTIN2, stimulating T-cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG). DNAM-1 Protein competes with PVRIG for NECTIN2-binding and interacts with PVR and NECTIN2. DNAM-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DNAM-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

DNAM-1 Protein, a cell surface receptor, is involved in intercellular adhesion, lymphocyte signaling, cytotoxicity, and lymphokine secretion mediated by cytotoxic T-lymphocytes (CTL) and natural killer (NK) cells. It acts as a receptor for NECTIN2 and, upon ligand binding, stimulates T-cell proliferation and cytokine production, including IL2, IL5, IL10, IL13, and IFNG. DNAM-1 Protein competes with PVRIG for NECTIN2-binding and interacts with PVR and NECTIN2.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

Q8K4F0 (E19-P254)

Gene ID
Molecular Construction
N-term
DNAM-1 (E19-P254)
Accession # Q8K4F0
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
DNAX accessory molecule 1; DNAM-1; CD226 antigen; CD226
AA Sequence

EETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNTGTKTVSIAVYNPNHNMHIESNYLHRVHFLNSTVGFRNMSLSFYNASEADIGIYSCLFHAFPNGPWEKKIKVVWSDSFEIAAPSDSYLSAEPGQDVTLTCQLPRTWPVQQVIWEKVQPHQVDILASCNLSQETRYTSKYLRQTRSNCSQGSMKSILIIPNAMAADSGLYRCRSEAITGKNKSFVIRLIITDGGTNKHFILP

Molecular Weight

35-50 kDa

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DNAM-1 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DNAM-1 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72669
Quantity:
MCE Japan Authorized Agent: