1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Carboxypeptidase
  4. Carboxypeptidase B
  5. Carboxypeptidase B2
  6. Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His)

Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His)

Cat. No.: HY-P75450
Handling Instructions Technical Support

Carboxypeptidase B2/CPB2 protein cleaves C-terminal arginine or lysine residues from active peptides, regulating their activities. It also down-regulates fibrinolysis by removing C-terminal lysine residues from degraded fibrin. CPB2 contributes to peptide signaling and fibrinolysis regulation. Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Carboxypeptidase B2/CPB2 protein cleaves C-terminal arginine or lysine residues from active peptides, regulating their activities. It also down-regulates fibrinolysis by removing C-terminal lysine residues from degraded fibrin. CPB2 contributes to peptide signaling and fibrinolysis regulation. Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Carboxypeptidase B2/CPB2 protein functions by cleaving C-terminal arginine or lysine residues from biologically active peptides, such as kinins or anaphylatoxins, in the circulation, thereby regulating their activities. It also plays a role in down-regulating fibrinolysis by removing C-terminal lysine residues from partially degraded fibrin, which has been acted upon by plasmin. This protein thus contributes to the fine-tuning of peptide signaling and the regulation of fibrinolysis processes.

Biological Activity

Specific activity is determined by a kinetic assay using Hippuryl-L-Arginine as substrate. One unit equals one micromole of Hippuryl-L-Arginine hyrolyzed per minute. Specific activity is reported in Units per milligram. The specific activity is 3.27 U/mg. (Activation description: The proenzyme needs to be activated by the mixture of Thrombin (HY-114164) and Human Thrombomodulin (HY-P70724) for an activated form.)

Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

Q9JHH6 (F22-T422)

Gene ID
Molecular Construction
N-term
Cpb2 (M1-T422)
Accession # Q9JHH6
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Carboxypeptidase B2; CPU; pCPB; TAFI; CPB2
AA Sequence

FQSGQVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVDSVKAHLNVSRIPFNVLMNNVEDLIEQQTFNDTVSPRASASYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSFEKYPLYVLKVSGKEQRIKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENLYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSAHKNNRCVGTDLNRNFASKHWCEKGASSSSCSETYCGLYPESEPEVKAVADFLRRNIDHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERYIKPTCAEALAAISKIVWHVIRNT

Molecular Weight

Approximately 52-75 kDa due to the glycosylation.

Glycosylation
Yes
Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P75450
Quantity:
MCE Japan Authorized Agent: