1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-36
  5. IL-36 alpha
  6. Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His)

Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His)

Cat. No.: HY-P700210AF
Handling Instructions Technical Support

IL-36 alpha protein binds to the IL1RL2/IL-36R receptor and activates the NF-kappa-B and MAPK signaling pathways. Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-36 alpha protein binds to the IL1RL2/IL-36R receptor and activates the NF-kappa-B and MAPK signaling pathways. Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-36 alpha/IL-1F6 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

IL-36 alpha protein, a cytokine, binds to and signals through the IL1RL2/IL-36R receptor, activating NF-kappa-B and MAPK signaling pathways in target cells, thereby contributing to a pro-inflammatory response. As part of the IL-36 signaling system present in epithelial barriers and sharing similarities with the IL-1 system, IL-36 alpha seems integral to local inflammatory responses. It plays a crucial role in the skin inflammatory response by influencing keratinocytes, dendritic cells, and indirectly impacting T-cells, driving tissue infiltration, cell maturation, and proliferation. IL-36 alpha induces the production of various pro-inflammatory cytokines, including IL-12, IL-1 beta, IL-6, TNF-alpha, and IL-23 in bone marrow-derived dendritic cells (BMDCs), contributing to dendritic cell maturation by stimulating the surface expression of CD80, CD86, and MHC class II. Additionally, IL-36 alpha induces the production of IFN-gamma, IL-4, and IL-17 in cultured CD4(+) T-cells and splenocytes, possibly playing a role in T-cell maturation and proliferation. Its involvement in pro-inflammatory effects extends to the lung, where it induces the expression of CXCL1 and CXCL2 and the expression of TNF-alpha, IL-36c, IL-1A, IL-1B, CXCL1, and CXCL2 in isolated splenic CD11c(+) alveolar macrophages. IL-36 alpha may also be involved in T-cell maturation by stimulating the surface expression of CD40, CD80, and CD86 in splenic CD11c(+) cells. Furthermore, IL-36 alpha induces NF-kappa B activation in macrophages, and its interaction with TMED10 mediates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC), facilitating secretion.

Biological Activity

Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED50 for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is >1 x 105 IU/mg.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

Q9JLA2 (M1-H160)

Gene ID
Molecular Construction
N-term
IL-36α (M1-H160)
Accession # Q9JLA2
6*His
C-term
Protein Length

Full Length

Synonyms
Il36a; Fil1e; Il1e; Il1f6; Il1h1Interleukin-36 alpha; FIL1 epsilon; Interleukin-1 epsilon; IL-1 epsilon; Interleukin-1 family member 6; IL-1F6; Interleukin-1 homolog 1; IL-1H1
AA Sequence

MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

Predicted Molecular Mass
18.8 kDa
Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-36 alpha/IL-1F6 Protein, Mouse (His)
Cat. No.:
HY-P700210AF
Quantity:
MCE Japan Authorized Agent: