1. Neuronal Signaling
  2. Amyloid-β
  3. (Pyr3)-Amyloid β-Protein (3-42)

(Pyr3)-Amyloid β-Protein (3-42) is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

(Pyr3)-Amyloid β-Protein (3-42)

(Pyr3)-Amyloid β-Protein (3-42) Chemical Structure

CAS No. : 183449-57-2

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other In-stock Forms of (Pyr3)-Amyloid β-Protein (3-42):

Other Forms of (Pyr3)-Amyloid β-Protein (3-42):

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

(Pyr3)-Amyloid β-Protein (3-42) is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits[1].

Molecular Weight

4309.86

Formula

C196H299N53O55S

CAS No.
Sequence

{Pyr}-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala

Sequence Shortening

{Pyr}-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
(Pyr3)-Amyloid β-Protein (3-42)
Cat. No.:
HY-P4882
Quantity:
MCE Japan Authorized Agent: