2. Peptides
  3. Peptide and Derivatives
  4. Others
  5. Drug Derivatives

Drug Derivatives

Custom Peptide Synthesis

Drug-derived peptides are peptide fragments or intermediates derived from active pharmaceutical molecules or candidate compounds. They are widely utilized in studies of drug structure.

Drug Derivatives (55):

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-160429
    PSAR18-COOH 2313534-26-6 99.86%
    PSAR18-COOH is a derivative of PSAR extracted from patent WO2009064913A1. PSAR is a highly hydrophilic, biodegradable, non-immunogenic and water-soluble polymer that has been employed in several delivery systems for drugs or diagnostics.
    PSAR18-COOH
  • HY-P1505A
    C3a (70-77) TFA 99.79%
    C3a (70-77) TFA (Complement 3a (70-77) TFA) is an octapeptide corresponding to the COOH terminus of C3a, exhibits the specificity and 1 to 2% biologic activities of C3a.
    C3a (70-77) TFA
  • HY-P3146A
    FTISADTSK acetate 99.66%
    FTISADTSK acetate is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM).
    FTISADTSK acetate
  • HY-Z11724
    Semaglutide Main Chain (9-37) 1169630-82-3 99.62%
    Semaglutide Main Chain (9-37) is a peptide starting material in the synthesis of semaglutide (HY-114118).
    Semaglutide Main Chain (9-37)
  • HY-P10474
    RYTVELA 1200829-06-6 98.89%
    RYTVELA is a deriviative of the peptide antagonist of interleukin-1 receptor 1 (IL-1R1) d-(RYTVELA) (HY-P10353) that contains all L-amino acids.
    RYTVELA
  • HY-P10697B
    H-PEG6-VH4127-NH2
    H-PEG6-VH4127-NH2 is a VH4127 (HY-P10697) derivative that facilitates further conjugation with proteins.
    H-PEG6-VH4127-NH2
  • HY-P3207A
    DLPLTFGGGTK TFA 98.11%
    DLPLTFGGGTK (TFA) is a surrogate peptide for pembrolizumab identification.
    DLPLTFGGGTK TFA
  • HY-P1223
    Exendin-3/4 (59-86) 1263874-37-8 98.19%
    Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.
    Exendin-3/4 (59-86)
  • HY-P1225
    {Val1}-Exendin-3/4 99.45%
    {Val1}-Exendin-3/4 is the first N-terminal 1-28 residues of Exendin-4 peptide.
    {Val1}-Exendin-3/4
  • HY-P1355A
    Cyclosporin A-Derivative 1 Free base 286852-20-8 98.80%
    Cyclosporin A-Derivative 1 (Free base) is a crystalline intermediate derived from the opening of cyclosporin A extracted from patent WO 2013167703 A1. Cyclosporin A is an immunosuppressive agent which can bind to the cyclophilin and inhibit calcineurin.
    Cyclosporin A-Derivative 1 Free base
  • HY-P1157
    Exendin derivative 1 98.94%
    Exendin derivative 1 is a 39 amino acid peptide.
    Exendin derivative 1
  • HY-P1574
    [Arg8]-Vasotocin 113-80-4
    [Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family.
    [Arg8]-Vasotocin
  • HY-P1227
    SDV-Exendin-3/4
    SDV-Exendin-3/4 is a 32-amino acid peptide.
    SDV-Exendin-3/4
  • HY-P1574A
    [Arg8]-Vasotocin TFA 98.41%
    [Arg8]-Vasotocin (TFA) is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family.
    [Arg8]-Vasotocin TFA
  • HY-P1229
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 98.01%
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • HY-P1231
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 99.03%
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • HY-P1505
    C3a (70-77) 63555-63-5
    C3a (70-77) is an octapeptide corresponding to the COOH terminus of C3a, exhibits the specificity and 1 to 2% biologic activities of C3a.
    C3a (70-77)
  • HY-P3147A
    IYPTNGYTR acetate 99.41%
    IYPTNGYTR acetate, a deamidation-sensitive signature peptide, is a deamidation product of Trastuzumab. IYPTNGYTR acetate can be used to monitor in vivo Trastuzumab metabolism.
    IYPTNGYTR acetate
  • HY-P3149B
    LEESGGGLVQPGGSMK acetate 99.01%
    LEESGGGLVQPGGSMK acetate, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK acetate can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
    LEESGGGLVQPGGSMK acetate
  • HY-P3203A
    DSTYSLSSTLTLSK TFA 98.11%
    DSTYSLSSTLTLSK TFA is a generic human peptide and can be used for infliximab quantitative detection. Infliximab (Avakine) is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
    DSTYSLSSTLTLSK TFA