2. Peptides
  3. Peptide and Derivatives
  4. Others
  5. Drug Derivatives

Drug Derivatives

Custom Peptide Synthesis

Drug-derived peptides are peptide fragments or intermediates derived from active pharmaceutical molecules or candidate compounds. They are widely utilized in studies of drug structure.

Drug Derivatives (55):

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-160429
    PSAR18-COOH 2313534-26-6 99.86%
    PSAR18-COOH is a derivative of PSAR extracted from patent WO2009064913A1. PSAR is a highly hydrophilic, biodegradable, non-immunogenic and water-soluble polymer that has been employed in several delivery systems for drugs or diagnostics.
    PSAR18-COOH
  • HY-P1505A
    C3a (70-77) TFA 99.79%
    C3a (70-77) TFA (Complement 3a (70-77) TFA) is an octapeptide corresponding to the COOH terminus of C3a, exhibits the specificity and 1 to 2% biologic activities of C3a.
    C3a (70-77) TFA
  • HY-Z11724
    Semaglutide Main Chain (9-37) 1169630-82-3 99.62%
    Semaglutide Main Chain (9-37) is a peptide starting material in the synthesis of semaglutide (HY-114118).
    Semaglutide Main Chain (9-37)
  • HY-P3146A
    FTISADTSK acetate 99.66%
    FTISADTSK acetate is an endogenous stable signature peptide from Trastuzumab monitored by selected reaction monitoring (SRM).
    FTISADTSK acetate
  • HY-P10474
    RYTVELA 1200829-06-6 98.89%
    RYTVELA is a deriviative of the peptide antagonist of interleukin-1 receptor 1 (IL-1R1) d-(RYTVELA) (HY-P10353) that contains all L-amino acids.
    RYTVELA
  • HY-P10697B
    H-PEG6-VH4127-NH2
    H-PEG6-VH4127-NH2 is a VH4127 (HY-P10697) derivative that facilitates further conjugation with proteins.
    H-PEG6-VH4127-NH2
  • HY-P3207A
    DLPLTFGGGTK TFA 98.11%
    DLPLTFGGGTK (TFA) is a surrogate peptide for pembrolizumab identification.
    DLPLTFGGGTK TFA
  • HY-P4917A
    Somatostatin-14 (reduced) TFA 99.79%
    Somatostatin-14 (reduced) (SST 14) (TFA) is a peptide that can be discovered through peptide screening. Peptide screening is a research tool primarily used for identifying active peptides through immunoassays. It can be employed in protein interactions, functional analysis, antigen epitope screening, and is particularly useful in the research and development of active molecules.
    Somatostatin-14 (reduced) TFA
  • HY-P1223
    Exendin-3/4 (59-86) 1263874-37-8 98.19%
    Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.
    Exendin-3/4 (59-86)
  • HY-P1225
    {Val1}-Exendin-3/4 99.45%
    {Val1}-Exendin-3/4 is the first N-terminal 1-28 residues of Exendin-4 peptide.
    {Val1}-Exendin-3/4
  • HY-P1355A
    Cyclosporin A-Derivative 1 Free base 286852-20-8 98.80%
    Cyclosporin A-Derivative 1 (Free base) is a crystalline intermediate derived from the opening of cyclosporin A extracted from patent WO 2013167703 A1. Cyclosporin A is an immunosuppressive agent which can bind to the cyclophilin and inhibit calcineurin.
    Cyclosporin A-Derivative 1 Free base
  • HY-P1157
    Exendin derivative 1 98.94%
    Exendin derivative 1 is a 39 amino acid peptide.
    Exendin derivative 1
  • HY-P1574
    [Arg8]-Vasotocin 113-80-4
    [Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family.
    [Arg8]-Vasotocin
  • HY-P1227
    SDV-Exendin-3/4
    SDV-Exendin-3/4 is a 32-amino acid peptide.
    SDV-Exendin-3/4
  • HY-P1574A
    [Arg8]-Vasotocin TFA 98.41%
    [Arg8]-Vasotocin (TFA) is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family.
    [Arg8]-Vasotocin TFA
  • HY-P1229
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 98.01%
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • HY-P1231
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS 99.03%
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • HY-P1505
    C3a (70-77) 63555-63-5
    C3a (70-77) is an octapeptide corresponding to the COOH terminus of C3a, exhibits the specificity and 1 to 2% biologic activities of C3a.
    C3a (70-77)
  • HY-P3147A
    IYPTNGYTR acetate 99.41%
    IYPTNGYTR acetate, a deamidation-sensitive signature peptide, is a deamidation product of Trastuzumab. IYPTNGYTR acetate can be used to monitor in vivo Trastuzumab metabolism.
    IYPTNGYTR acetate
  • HY-P3149B
    LEESGGGLVQPGGSMK acetate 99.01%
    LEESGGGLVQPGGSMK acetate, a proteolysis peptide, is a component of Infliximab. LEESGGGLVQPGGSMK acetate can be used for quantitative analysis of Infliximab. Infliximab is a chimeric monoclonal IgG1 antibody that specifically binds to TNF-α.
    LEESGGGLVQPGGSMK acetate