1. GPCR/G Protein Neuronal Signaling
  2. Neuropeptide Y Receptor
  3. Peptide YY (pig)

Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Peptide YY (pig)

Peptide YY (pig) Chemical Structure

CAS No. : 81858-94-8

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products

View All Neuropeptide Y Receptor Isoform Specific Products:

  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system[1][2][3].

IC50 & Target[3]

NPY Y2 receptor

 

In Vitro

Peptide YY (pig) (10 μg/mL) has antibody specificity (for PYY antiserum), as well as human pancreatic polypeptide (PP). Both of them may play endocrine or paracrine roles in the regulation of islet hormone secretion in various vertebrate species[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Peptide YY1-36 (pig) is degraded to PYY3-36 by dipeptidyl peptidase IV (DPP-IV), and PYY3-36 (50 nmol/kg; i.v.; single dose) is further broken down into many metabolism in Göttingen mini-pig and Rhesus monkey[3].
Peptide YY1-36 (pig) shows other physiological effects including slowing of intestinal transit, inhibition of gastrointestinal anion and electrolyte secretion and lowering of blood glucose[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4240.72

Formula

C190H288N54O57

CAS No.
Sequence Shortening

YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Peptide YY (pig)
Cat. No.:
HY-P2703
Quantity:
MCE Japan Authorized Agent: