1. Academic Validation
  2. Exogenous GalR2-specific peptide agonist as a tool for treating myocardial ischemia/reperfusion injury

Exogenous GalR2-specific peptide agonist as a tool for treating myocardial ischemia/reperfusion injury

  • Fundam Clin Pharmacol. 2023 Dec;37(6):1109-1118. doi: 10.1111/fcp.12925.
Larisa Serebryakova 1 Oksana Veselova 1 Irina Studneva 1 Igor Dobrokhotov 1 Marina Palkeeva 1 Dmitry Avdeev 1 Alexander Molokoedov 1 Michael Ovchinnikov 1 Maria Sidorova 1 Oleg Pisarenko 1
Affiliations

Affiliation

  • 1 Chazov National Medical Research Center of Cardiology, Moscow, Russia.
Abstract

Objectives: The aim of this work was to elucidate the role of GalR2 receptor activation in protecting the rat heart in vivo from ischemia/reperfusion (I/R) damage by a pharmacological peptide agonist WTLNSAGYLLGPβAH-OH (G1) and full-length rat Galanin GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 (G2) using M871, a selective inhibitor of GalR2.

Methods: The peptides were prepared by the automatic solid-phase synthesis using the Fmoc-strategy and purified by high-performance liquid chromatography (HPLC). A 40-min left anterior descending (LAD) coronary artery occlusion followed by a 60-min reperfusion was performed. The criteria for damage/protection of the heart were the infarct size (IS) and plasma activity of creatine kinase-MB (CK-MB) at the end of reperfusion.

Results: Intravenous injection of G1 or G2 at an optimal dose of 1 mg/kg at the fifth minute of reperfusion significantly reduced the IS (by 35% and 32%, respectively) and activity of CK-MB at the end of reperfusion (by 43% and 38%, respectively) compared with the control. Administration of M871 (8 mg/kg) 5 min before the onset of reperfusion abolished the effects of G1 on IS and CK-MB activity, returning them to control values. Co-administration of M871 (8 mg/kg) with G2 attenuated protective effect of G2 on both IS and plasma СK-MB activity. However, differences in these parameters between the M871+G2 and G2 groups did not reach statistical significance (P = 0.139 and P = 0.121, respectively).

Conclusion: Thus, GalR2 is the principal receptor subtype that transduces the protective effects of Galanin and ligand G1 in myocardial I/R injury. This suggests that GalR2-specific peptide agonists could be used as drug candidates for treating ischemic heart disease.

Keywords

GalR2 receptor; M871; myocardial infarction; rat heart; solid-phase synthesis.

Figures
Products