1. GPCR/G Protein
  2. GCGR
  3. Glucagon-like peptide 1 (1-37), human TFA

Glucagon-like peptide 1 (1-37), human TFA  (Synonyms: HuGLP-1 TFA)

Cat. No.: HY-P1145A Purity: 98.09%
Handling Instructions Technical Support

Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Glucagon-like peptide 1 (1-37), human TFA

Glucagon-like peptide 1 (1-37), human TFA Chemical Structure

Size Price Stock Quantity
500 μg In-stock
1 mg In-stock
5 mg In-stock
10 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of Glucagon-like peptide 1 (1-37), human TFA:

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Glucagon-like peptide 1 (1-37), human TFA

  • Biological Activity

  • Protocol

  • Purity & Documentation

  • References

  • Customer Review

Description

Glucagon-like peptide 1 (1-37), human (TFA) is a highly potent agonist of the GLP-1 receptor.

IC50 & Target

GLP-1 receptor[1].

In Vitro

Glucagon-like peptide-1 (GLP-1) is produced by the posttranslational processing of proglucagon and acts as a regulator of various homeostatic events. GLP-1(1-37) is more stable than GLP-1(7-37), with 94.7% of the initial amount of peptide left after a 4h exposure to mouse serum. GLP-1(1-37) is confirmed to be a highly potent agonist of the GLP-1 receptor (GLP-1R) by measuring the expression of the luciferase reporter gene expression in transiently transfected human embryonic kidney (HEK293) cells[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

GLP-1(1–37) decreases glycemic excursion in a dose-dependent. The administration of GLP-1(1–37) or GLP-1(7–37) markedly decrease blood glucose levels at 15 min and 30 min compared with the control group[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

4169.48 (free acid)

Formula

C186H275N51O59.xC2HF3O2

Appearance

Solid

Color

White to off-white

Sequence

His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Sequence Shortening

HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

DMSO : 1.8 mg/mL (Need ultrasonic; Hygroscopic DMSO has a significant impact on the solubility of product, please use newly opened DMSO)

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation
References
Cell Assay
[1]

HEK293 cells (5×104) are seeded in a 96-well plate and transiently cotransfected with the GLP-1R plasmid and the CRE-luciferase reporter plasmid. After a 48 h transfection, different concentrations of GLP-1(1–37) or GLP-1(7–37) (TFA) are added, and the cells are incubated for 5 h. The cells are harvested for a luciferase assay using a luciferase assay[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Administration
[1]

Mice[1]

The normal KM mice are fasted for 16 h before the administration (i.p.) of GLP-1 and glucose. GLP-1(1-37) (25 nmol/kg) with or without exendin(9-39) (250 nmol/kg) is given in combination with glucose (4 g/kg). GLP-1(7-37) (25 nmol/kg) with or without exendin(9-39) (250 nmol/kg) is also administrated in combination with glucose (4 g/kg). The control group is treated with saline (NaCl, 9 g/L) and glucose (4 g/kg). The IPGTT is carried out at 0, 15, 30 and 60 min after glucose and protein administration, and the blood glucose levels are measured as described above[1].

MCE has not independently confirmed the accuracy of these methods. They are for reference only.

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Glucagon-like peptide 1 (1-37), human TFA
Cat. No.:
HY-P1145A
Quantity:
MCE Japan Authorized Agent: