1. GPCR/G Protein
  2. GCGR
  3. GLP-1(7-37)

GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

GLP-1(7-37)

GLP-1(7-37) Chemical Structure

CAS No. : 106612-94-6

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg In-stock
25 mg In-stock
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 7 publication(s) in Google Scholar

Other Forms of GLP-1(7-37):

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.

In Vivo

GLP-1(7-37) (0.5, 5 or 50 pmol/min/kg) infused during the second hour of a 2-hour 11-mM hyperglycemic clamp produces a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion in rats[2].
Infusion of GLP-1(7-37) (5 pmol/min/kg) from 1 hour through 7 hours produces a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle in rats with maintained glucose concentration at 11 mM[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: Male Sprague-Dawley rats weighing 300 to 350 g with maintained plasma glucose concentration at 11 mM[2].
Dosage: 0.5, 5 or 50 pmol/min/kg.
Administration: IV during the second hour of a 2-hour 11-mmol/L hyperglycemic clamp.
Result: Produced a dose-related enhancement of the glucose-stimulated increase in plasma insulin concentration and an increased rate of glucose infusion.
Animal Model: Male Sprague-Dawley rats weighing 300 to 350 g with glucose IV at a variable rate for 7 hours to maintain plasma glucose concentration at 11 mM[2].
Dosage: 5 pmol/min/kg.
Administration: IV from 1 hour through 7 hours[2].
Result: Produced a sustained increase in plasma insulin concentration relative to levels in rats infused with vehicle.
Molecular Weight

3355.67

Formula

C151H228N40O47

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly

Sequence Shortening

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Solvent & Solubility
In Vitro: 

0.1 M HCl : ≥ 50 mg/mL (14.90 mM)

80% Acetic acid/water : ≥ 10 mg/mL (2.98 mM)

DMSO : < 1 mg/mL (insoluble or slightly soluble)

H2O : < 0.1 mg/mL (insoluble)

*"≥" means soluble, but saturation unknown.

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2980 mL 1.4900 mL 2.9800 mL
5 mM 0.0596 mL 0.2980 mL 0.5960 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

  • Molarity Calculator

  • Dilution Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass
=
Concentration
×
Volume
×
Molecular Weight *

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start)

C1

×
Volume (start)

V1

=
Concentration (final)

C2

×
Volume (final)

V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
Purity & Documentation

Purity: 99.89%

References

Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

Optional Solvent Concentration Solvent Mass 1 mg 5 mg 10 mg 25 mg
80% Acetic acid/water / 0.1 M HCl 1 mM 0.2980 mL 1.4900 mL 2.9800 mL 7.4501 mL
0.1 M HCl 5 mM 0.0596 mL 0.2980 mL 0.5960 mL 1.4900 mL
10 mM 0.0298 mL 0.1490 mL 0.2980 mL 0.7450 mL
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GLP-1(7-37)
Cat. No.:
HY-P0055
Quantity:
MCE Japan Authorized Agent: