1. Recombinant Proteins
  2. Others
  3. MD2 Protein, Human (His)

MD2 protein binds bacterial lipopolysaccharide (LPS) and collaborates with TLR4 in the innate immune response to LPS. It also interacts with TLR2 in the response to cell wall components from bacteria. MD2 enhances TLR4-dependent NF-kappa-B activation and forms a heterogeneous homomer, participating in a multi-protein complex with CD14 and TLR4. Ligand binding induces complex oligomerization, crucial for the cellular response to LPS. MD2 Protein, Human (His) is the recombinant human-derived MD2 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MD2 protein binds bacterial lipopolysaccharide (LPS) and collaborates with TLR4 in the innate immune response to LPS. It also interacts with TLR2 in the response to cell wall components from bacteria. MD2 enhances TLR4-dependent NF-kappa-B activation and forms a heterogeneous homomer, participating in a multi-protein complex with CD14 and TLR4. Ligand binding induces complex oligomerization, crucial for the cellular response to LPS. MD2 Protein, Human (His) is the recombinant human-derived MD2 protein, expressed by E. coli , with C-His labeled tag.

Background

MD2 Protein, a key player in the innate immune response, serves as a critical component in recognizing bacterial lipopolysaccharide (LPS) and coordinating immune reactions. It binds directly to LPS and collaborates with TLR4 to elicit the innate immune response to bacterial LPS. Moreover, MD2 works in tandem with TLR2, responding to cell wall components from both Gram-positive and Gram-negative bacteria. MD2's interaction with TLR4 enhances NF-kappa-B activation, emphasizing its role in signaling pathways. In cell contexts expressing both LY96 and TLR4, MD2 enables responsiveness to LPS, underlining its importance in the cellular recognition of bacterial components. Structurally, MD2 forms a heterogeneous homomer from homodimers linked by disulfide bonds and is a crucial component of the lipopolysaccharide (LPS) receptor complex, which includes at least CD14, LY96, and TLR4. MD2's ligand binding induces interactions with TLR4 and promotes the oligomerization of the complex, further highlighting its central role in the immune response to bacterial challenges.

Species

Human

Source

E. coli

Tag

C-His

Accession

Q9Y6Y9-1 (Q19-N160)

Gene ID

/

Molecular Construction
N-term
MD2 (Q19-N160)
Accession # Q9Y6Y9-1
His
C-term
Synonyms
Lymphocyte antigen 96; LY96; Ly-96; ESOP1; ESOP-1; MD-2;
AA Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKRSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Molecular Weight

18.07 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in 4 mM HCL. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MD2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MD2 Protein, Human (His)
Cat. No.:
HY-P701067
Quantity:
MCE Japan Authorized Agent: