Search Result

Results for "

angiotensin-converting-enzymes

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Angiotensin Receptor (12) Angiotensin-converting Enzyme (ACE) (195) 11β-HSD (3) Adenosine Receptor (1) Adrenergic Receptor (1) Akt (5) Apoptosis (23) Autophagy (3) Bradykinin Receptor (1) Carboxypeptidase (1) Casein Kinase (3) Caspase (2) CDK (1) Cholinesterase (ChE) (1) Dopamine Receptor (1) Drug Metabolite (15) Endogenous Metabolite (15) GnRH Receptor (1) HIV (1) HSV (1) Influenza Virus (2) Interleukin Related (2) Isotope-Labeled Compounds (27) mAChR (3) MMP (6) Neprilysin (6) NF-κB (7) Opioid Receptor (1) Parasite (3) Reactive Oxygen Species (5) Reference Standards (2) Renin (1) SARS-CoV (5) Sirtuin (5) STAT (5) TNF Receptor (2) Toll-like Receptor (TLR) (2) Xanthine Oxidase (1)
By Research Areas:	Cancer (40) Cardiovascular Disease (185) Endocrinology (5) Infection (10) Inflammation/Immunology (22) Metabolic Disease (22) Neurological Disease (13)

By Targets:

Angiotensin Receptor (12)

Angiotensin-converting Enzyme (ACE) (195)

11β-HSD (3)

Adenosine Receptor (1)

Adrenergic Receptor (1)

Akt (5)

Apoptosis (23)

Autophagy (3)

Bradykinin Receptor (1)

Carboxypeptidase (1)

Casein Kinase (3)

Caspase (2)

CDK (1)

Cholinesterase (ChE) (1)

Dopamine Receptor (1)

Drug Metabolite (15)

Endogenous Metabolite (15)

GnRH Receptor (1)

HIV (1)

HSV (1)

Influenza Virus (2)

Interleukin Related (2)

Isotope-Labeled Compounds (27)

mAChR (3)

MMP (6)

Neprilysin (6)

NF-κB (7)

Opioid Receptor (1)

Parasite (3)

Reactive Oxygen Species (5)

Reference Standards (2)

Renin (1)

SARS-CoV (5)

Sirtuin (5)

STAT (5)

TNF Receptor (2)

Toll-like Receptor (TLR) (2)

Xanthine Oxidase (1)

By Research Areas:

Cancer (40)

Cardiovascular Disease (185)

Endocrinology (5)

Infection (10)

Inflammation/Immunology (22)

Metabolic Disease (22)

Neurological Disease (13)

238

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Peptides

Inhibitory Antibodies

Natural
Products

Isotope-Labeled Compounds

Targets Recommended: Angiotensin-converting Enzyme (ACE) Angiotensin Receptor Endothelin-Converting Enzyme (ECE) Proteolytic Enzyme NEDD8-activating Enzyme E1/E2/E3 Enzyme

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P2983

**Angiotensin-converting enzyme** Kininase II; CD143	Endogenous Metabolite	Cardiovascular Disease Cancer
Angiotensin-converting enzyme (Kininase II) is a dicarboxypeptidase, it converts inactive Angiotensin I (Ang I) to active Ang II and degrades active bradykinin (BK). Angiotensin-converting enzyme is a potent vasoconstrictor, is often used in biochemical studies .

HY-108321

Zofenopril	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Zofenopril is an **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀** of 81 μM.

HY-U00041

Pivalopril 1 Publications Verification Pivopril; RHC 3659(S)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Pivalopril is a new orally active angiotensin converting enzyme (ACE) inhibitor.

HY-107337

Delapril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases .

HY-50761

Libenzapril Abutapril; CGS-16617	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Endocrinology
Libenzapril (Abutapril; CGS-16617) is an orally active, potent direct-acting angiotensin-converting-enzyme (ACE) inhibitor. Libenzapril has the potential for ischemia-induced heart failure research .

HY-P1792A

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P1792

Angiotensin II (1-4), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-122032

A 58365A	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
A 58365A is a potent angiotensin converting enzyme (ACE) inhibitor .

HY-101681

Utibapril FPL 63547	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Utibapril is an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activities.

HY-P0143

Leucylarginylproline	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Leucylarginylproline is an angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 0.27μM.

HY-B0279

Ramipril 2 Publications Verification HOE-498	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Cancer
Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-U00074

Rentiapril racemate SA-446 racemate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Rentiapril racemate (SA-446 racemate) is the racemate of Rentiapril. Rentiapril is an **angiotensin converting enzyme (ACE**) inhibitor.

HY-123657

RXP 407	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RXP 407 is a potent and selective Angiotensin-converting Enzyme (ACE) inhibitor with a K_i of 12nM .

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-106446

Rentiapril SA-446	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Rentiapril is an orally active angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity .

HY-B0331A

Enalapril maleate 5+ Cited Publications MK-421 maleate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) maleate, the active metabolite of enalapril, is an angiotensin-converting enzyme (ACE) inhibitor.

HY-A0043A

Cilazapril monohydrate 1 Publications Verification Ro 31-2848 monohydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-A0043

Cilazapril 1 Publications Verification Ro 31-2848	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-A0043B

Cilazapril hydrochloride Ro 31-2848 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-P1444

Acein	Dopamine Receptor	Neurological Disease
Acein is a novel nonapeptide, H-Pro-Pro-Thr-Thr-Thr-Lys-Phe-Ala-Ala-OH. Acein can promote the release of dopamine. Acein targets angiotensin converting enzyme (ACE I). Angiotensin converting enzyme (ACE I) can be used in nervous system related research .

HY-116023

Moveltipril Moveltipril calcium; MC-838	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor .

HY-P2366

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Metabolic Disease
Teprotide is an inhibitor of angiotensin-converting enzyme (ACE) inhibitor. Teprotide can be used to study hypertensive .

HY-B0331AS

Enalapril D5 maleate MK-421-d₅(maleate)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.

HY-B0477

Quinapril hydrochloride 3 Publications Verification CI-906	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinapril (hydrochloride) (CI-906) is a proagent that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications.

HY-119025

L 681176	Angiotensin Receptor	Cardiovascular Disease
L 681176 is an angiotensin-converting enzyme inhibitor that can be isolated from STREPTOMYCES sp. MA 5143a .

HY-106816

Ceronapril Ceranapril; SQ 29852	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ceronapril (SQ 29852) is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with an IC₅₀ of 36 nM .

HY-P1488

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

HY-19022

BW A256C	Angiotensin Receptor	Cardiovascular Disease Others Metabolic Disease
Palatrigine is a compound with angiotensin-converting enzyme inhibitory and beta-adrenergic receptor blocking properties .

HY-107318

Alacepril Cetapril; DU-1219	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Alacepril (Cetapril) is an orally active angiotensin converting enzyme (ACE) inhibitor with long lasting antihypertensive effect .

HY-B0382

Fosinopril sodium 1 Publications Verification SQ28555	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril Sodium is the ester prodrug of an angiotensin-converting enzyme (ACE) inhibitor, used for the treatment of hypertension and some types of chronic heart failure.

HY-156862

(+)-Chloroquine	Angiotensin Receptor	Others
(+)-Chloroquine is a aminoquinoline drug impairs in vitro the terminal glycosylation of angiotensin-converting enzyme 2 (ACE-2) .

HY-P2072

GF109	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
GF109 is a potent parenteral inhibitor of angiotensin converting enzyme (ACE). GF109 has antihypertensive effects .

HY-113898

Ganoderic acid K	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ganoderic acid K is a potent **angiotensin converting enzyme** inhibitor. Ganoderic acid K is a triterpene that can be found in ganoderma lucidum .

HY-18207

Fasidotril Alatriopril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Fasidotril is a dual inhibitor of neprilysin and angiotensin-converting enzyme (ACE) for the potential research of hypertension and congestive heart failure (CHF).

HY-P1032

Angiotensin I (human, mouse, rat) 2 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-P5913

*[Tyr6]-Angiotensin* II**	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
[Tyr6]-Angiotensin II is a peptide fragment , and can bind to the angiotensin converting enzyme 2 .

HY-101577

NCX899	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NCX899 is a NO-releasing derivative of enalapril, and shows inhibitory activity against angiotensin-converting enzyme (ACE) activity.

HY-B0231AS

Enalaprilat-d5 MK-422 d₅	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-B0231BS

Enalaprilat-d5 sodium MK-422-d₅ sodium	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-B0331

Enalapril 5+ Cited Publications MK-421	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) is an angiotensin-converting enzyme (ACE) inhibitor, can be used for hypertensive diseases research .

HY-A0116S

Trandolaprilate-d5 Trandolaprilat d₅; RU 44403 d₅	Isotope-Labeled Compounds Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].

HY-18206

Lisinopril 4 Publications Verification MK-521	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-108321S

Zofenopril-d5	Isotope-Labeled Compounds Angiotensin-converting Enzyme (ACE)	Neurological Disease
Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.

HY-113681

REV 5975	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
REV 5975 is a angiotensin converting enzyme (ACE) inhibitor. REV 5975 shows a partial reduction of the angiotensin I effect .

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-B0331B

Enalapril sodium MK-421 sodium	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) sodium is an angiotensin-converting enzyme (ACE) inhibitor, can be used for hypertensive diseases research .

HY-123227

SQ 27786	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
SQ 27786 is an angiotensin converting enzyme (ACE) inhibitor and a diuretic agent. SQ 27786 can be utilized in cardiovascular disease research .

HY-113813

SQ 28853	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
SQ 28853 is an angiotensin converting enzyme (ACE) inhibitor with potent diuretic activity. SQ 28853 can be used for the research of cardiovascular .

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

Cat. No.	Product Name

HY-L052

Anti-COVID-19 Compound Library

1,462 compounds

COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.

Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1,462 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Cat. No.	Product Name	Type

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly

FAPGG

Chromogenic Substrates Amino acids and Derivatives

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a specific substrate of angiotensin converting enzyme (ACE) with a Ki of 2.546×10 ^-4 M. It is used as a chromogenic probe for quantitative detection of ACE activity. N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly can be hydrolyzed by ACE to generate N-[3-(2-furyl)acryloyl]-Phe (FAP) and Gly-Gly, and the ACE inhibitory effect is monitored by photometry. FAPGG competitively binds to the active center of ACE and is a key tool for screening ACE inhibitors such as Captopril (HY-B0368) and Dioscorin. Its reversible mechanism of action supports hypertension research and drug development targeting the renin-angiotensin system .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Chromogenic Substrates
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Cat. No.	Product Name	Target	Research Area

HY-P1488

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

HY-P1032

Angiotensin I (human, mouse, rat) 2 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-P1792A

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P1792

Angiotensin II (1-4), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-P1444

Acein	Dopamine Receptor	Neurological Disease
Acein is a novel nonapeptide, H-Pro-Pro-Thr-Thr-Thr-Lys-Phe-Ala-Ala-OH. Acein can promote the release of dopamine. Acein targets angiotensin converting enzyme (ACE I). Angiotensin converting enzyme (ACE I) can be used in nervous system related research .

HY-P2366

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Metabolic Disease
Teprotide is an inhibitor of angiotensin-converting enzyme (ACE) inhibitor. Teprotide can be used to study hypertensive .

HY-P2072

GF109	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
GF109 is a potent parenteral inhibitor of angiotensin converting enzyme (ACE). GF109 has antihypertensive effects .

HY-P5913

*[Tyr6]-Angiotensin* II**	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
[Tyr6]-Angiotensin II is a peptide fragment , and can bind to the angiotensin converting enzyme 2 .

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Caspase Angiotensin-converting Enzyme (ACE)	Others
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-P2616A

Mca-YVADAP-Lys(Dnp)-OH TFA	Cholinesterase (ChE) Caspase	Others
Mca-YVADAP-Lys(Dnp)-OH TFA is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-P4524

FA-Phe-Phe	Angiotensin-converting Enzyme (ACE)	Others
FA-Phe-Phe is a furylacryloyl (fa)-amino acid derivative, targeting to Angiotensin-converting Enzyme (ACE). FA-Phe-Phe is also a specific substrate of Cathepsin A .

HY-P2605

Tuna AI	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Tuna AI, an angiotensin-converting enzyme (ACE) inhibitor, exhibits IC₅₀ values of 1 μM and 2 μM for ACEs from bovine and rabbit lungs, respectively .

HY-P10391

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific angiotensin-converting enzyme (ACE) inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

HY-P1044A

Spinorphin TFA LVV-hemorphin-4 TFA	Angiotensin Receptor	Neurological Disease
Spinorphin TFA is an inhibitor of enkephalin-degrading enzymes. Spinorphin inhibits aminopeptidase, dipeptidyl aminopeptidase III, angiotensin-converting enzyme and enkephalinase. Spinorphin possesses an antinociceptive effect .

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride 1 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-P4279

Ovalbumin (154-159)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ovalbumin (154-159) is a fragment from ovalbumin. Ovalbumin (154-159) is a potent angiotensin-converting enzyme (ACE) inhibitor. Ovalbumin (154-159) can be used for research of hypertension .

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

HY-P4654

H-Tyr-Lys-OH	Angiotensin-converting Enzyme (ACE)	Others
H-Tyr-Lys-OH is a dipeptide that can be used as a biomarker for AJH-1. H-Tyr-Lys-OH has a good binding affinity to angiotensin converting enzyme (ACE) .

HY-118060

Dipeptide 2 N-Valyltryptophan; Val-Trp	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Dipeptide 2 (N-Valyltryptophan; Val-Trp) is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient . Dipeptide 2 is an angiotensin-converting Enzyme (ACE) .

HY-P1032F

*Biotinyl-Angiotensin* I (human, mouse, rat)**	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the **angiotensin-converting enzyme** (ACE) .

HY-P10791

YYLLVR	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
YYLLVR is an angiotensin-converting enzyme (ACE) inhibitory peptide with an inhibitory rate of 89.10%. YYLLVR has a lower binding energy for ACE of -35.98 kcal/mol. YYLLVR can be used in the study of hypertensive diseases .

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-P4257

L-Isoleucyl-L-arginine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
L-Isoleucyl-L-arginine is a dipeptide formed from L-isoleucine and L-arginine residues. L-Isoleucyl-L-arginine is a potent angiotensin-converting enzyme (ACE) inhibitor. L-Isoleucyl-L-arginine can be used for research of hypertension .

HY-P4281

Ovotransferrin (328-332)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Neurological Disease
Ovotransferrin (328-332) has a protective activity on the blood pressure by inhibiting the Angiotensin-Converting Enzyme (ACE), with the IC₅₀ of 20 μM. Ovotransferrin (328-332) fragment has an activity against Cholinesterase (ChE), implicating in Alzheimer’s diseases .

HY-P3006

*Des-Leu10-angiotensin* I**	Drug Metabolite	Cardiovascular Disease
Des-Leu10-angiotensin I is a nonapeptide that inhibits rabbit lung angiotensin-converting enzyme peptidyl-dipeptide hydrolase with a K_i value of 31 μM, which is generated from angiotensin I by the action of carboxypeptidase-like activities residing in the human platelet and mast cell .

HY-P4739

LHRH (1-5) (free acid)	GnRH Receptor	Others
LHRH (1-5) (free acid) is a polypeptide generated by the cleavage of LHRH at the Tyr ⁵5-Gly ⁶6 site. LHRH (1-5) (free acid) is converted into LHRH (1-3) and LHRH (4-5) fragments under the catalysis of Angiotensin-converting enzyme (HY-P2983) .

HY-P0266B

N-Acetyl-Ser-Asp-Lys-Pro acetate Ac-SDKP acetate	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate is a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE). N-Acetyl-Ser-Asp-Lys-Pro acetate is a natural inhibitor of pluripotent hematopoietic stem cell proliferation. Anti-inflammatory and antifibrotic properties .

HY-P4554

H-Phe-Arg-OH	Endogenous Metabolite	Metabolic Disease
H-Phe-Arg-OH is a dipeptide containing phenylalanine and arginine. H-Phe-Arg-OH can be separated from Bradykinin (HY-P0206) through Angiotensin-converting enzyme (ACE, HY-P2983). H-Phe-Arg-OH can be used for metabolic research .

HY-P4560

H-Pro-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of **Angiotensin-converting enzyme (ACE**, HY-P2983) .

HY-P10601

αs1-CN f(143–149)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) is an orally active casein-derived peptide sequence. αs1-CN f(143–149) exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

HY-P3976

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure .

HY-P10808

RSRGVFF	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RSRGVFF (FOXP3 inhibitor P60) is a mixed-type angiotensin-converting enzyme (ACE) inhibitor with blood-brain barrier permeability, boasting an IC₅₀ value of 5.01 μM . RSRGVFF is capable of binding to both active and non-active sites of ACE and its substrate HHL complex, thus reducing the catalytic activity of ACE. RSRGVFF can be further utilized for research on lowering hypertension .

HY-P1032S2

Angiotensin I-13C6,15N (human, mouse, rat) TFA	Isotope-Labeled Compounds Endogenous Metabolite	Others
Angiotensin I-13C6,15N (human, mouse, rat) TFA is ¹³C and ¹⁵N labeled Angiotensin I (human, mouse, rat) TFA. Angiotensin I-13C6,15N (human, mouse, rat) TFA is a precursor of angiotensin II and is cleaved into angiotensin II by angiotensin converting enzyme (ACE) .

HY-P1829

Angiotensin I/II (1-6)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P1829A

Angiotensin I/II (1-6) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P4641

H-Trp-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Trp-Phe-OH is a dipeptide consisting of tryptophan and phenylalanine (Trp-Phe). H-Trp-Phe-OH is also an antihypertensive peptide with inhibitory activity on angiotensin-converting enzyme (ACE), dose-dependently increases NO levels, and decreases endothelin-1 (ET-1) levels. H-Trp-Phe-OH (2 mg/kg; subcutaneous injection; 6 injections over 3 days) causes an increase in ovarian weight in female mice .

HY-W011258

H-Tyr-Phe-OH L-Tyrosyl-L-phenylalanine	Xanthine Oxidase Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology Cancer
H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) is an orally active inhibitor of **Angiotensin converting enzyme (ACE**), with an inhibiton rate of 48% at 50 μM. H-Tyr-Phe-OH can be used as an biomarker for differentiating benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH exhibits xanthine oxidase inhibition (uric acid lowering) activity and serves as regulator in IL-8 production in neutrophil-like cells .

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly FAPGG	Angiotensin-converting Enzyme (ACE)	Others
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a specific substrate of angiotensin converting enzyme (ACE) with a Ki of 2.546×10 ^-4 M. It is used as a chromogenic probe for quantitative detection of ACE activity. N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly can be hydrolyzed by ACE to generate N-[3-(2-furyl)acryloyl]-Phe (FAP) and Gly-Gly, and the ACE inhibitory effect is monitored by photometry. FAPGG competitively binds to the active center of ACE and is a key tool for screening ACE inhibitors such as Captopril (HY-B0368) and Dioscorin. Its reversible mechanism of action supports hypertension research and drug development targeting the renin-angiotensin system .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-18206

Lisinopril 4 Publications Verification MK-521	Cardiovascular Disease Classification of Application Fields Ketones, Aldehydes, Acids Source classification Endogenous metabolite Disease Research Fields	Angiotensin-converting Enzyme (ACE)
Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-125112

Vicenin-1	Cardiovascular Disease Flavonoids Classification of Application Fields Flavones Leguminosae Source classification Phenols Polyphenols Plants Disease Research Fields Trigonella foenum-graecum Linn.	Angiotensin-converting Enzyme (ACE)
Vicenin 1 is a C-glycosylflavone that has an inhibitory effect on angiotensin-converting enzyme (ACE)(IC₅₀=52.50 μM) .

HY-N9528

Lyciumin A	Cardiovascular Disease Alkaloids Monophenols Pyrrole Alkaloids Classification of Application Fields Source classification Phenols Plants Solanaceae Lycium chinense Miller Disease Research Fields Indole Alkaloids	Angiotensin-converting Enzyme (ACE) Renin
Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension .

HY-N4090

Vicenin 3	Cardiovascular Disease Structural Classification Classification of Application Fields Flavones Source classification Plants Desmodium styracifolium (Osbeck.) Merr. Flavonoids other families Leguminosae Phenols Polyphenols Disease Research Fields	Angiotensin-converting Enzyme (ACE)
Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium .

HY-A0116A

Trandolaprilate hydrate Trandolaprilat hydrate; RU 44403 hydrate	Cardiovascular Disease Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Trandolaprilate hydrate is a potent **angiotensin-converting enzyme (ACE*) inhibitor. Trandolaprilate hydrate partially inhibits angiotensin-I-mediated c-fos* induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-122032

A 58365A	Structural Classification Alkaloids Microorganisms Pyrrole Alkaloids Source classification	Angiotensin-converting Enzyme (ACE)
A 58365A is a potent angiotensin converting enzyme (ACE) inhibitor .

HY-N9314

Camellianin B	Adinandra nitida Merr. ex Li Flavonoids Classification of Application Fields Flavones Source classification Phenols Polyphenols Metabolic Disease Plants Disease Research Fields Theaceae	Angiotensin-converting Enzyme (ACE)
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities .

HY-N10860

5-O-beta-D-Glucopyranosylmyricanol	Structural Classification Other Monoterpenes Terpenoids Morella esculenta (Buch.-Ham. ex D. Don) I. M. Turner Source classification Plants Myricaceae	Angiotensin Receptor
5-O-beta-D-Glucopyranosylmyricanol is a diarylheptane compound isolated from Myrica esculenta that has a weak inhibitory effect on angiotensin-converting enzyme (ACE) .

HY-N1102

Vasicinol 6-Hydroxypeganine	Malvaceae Structural Classification Alkaloids Other Alkaloids Source classification Plants	Angiotensin-converting Enzyme (ACE)
Vasicinol is a reversible inhibitor of sucrase (IC₅₀: 250 μM). Vasicinol is a HbF inducer. Vasicinol also inhibits Angiotensin-converting Enzyme (ACE). Vasicinol is apyrroquinazoline alkaloid that can be isolated from Adhatoda vasica .

HY-A0116

Trandolaprilate Trandolaprilat; RU 44403	Cardiovascular Disease Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Trandolaprilate is a potent **angiotensin-converting enzyme (ACE*) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos* induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-N3470

Isomartynoside	Structural Classification Natural Products Source classification Populus tomentosa Plants Salicaceae	Angiotensin-converting Enzyme (ACE)
Isomartynoside is a potent angiotensin converting enzyme (ACE) inhibitor with an IC₅₀ value of 505.9 µM. Isomartynoside is a phenylpropanoid glycoside that can be found in Galeopsis pubescens . IC₅₀: 505.9 µM (ACE)

HY-N0214A

Peimisine hydrochloride Ebeiensine hydrochloride	Alkaloids Piperidine Alkaloids Structural Classification Liliaceae Classification of Application Fields Source classification Fritillaria ussuriensis Maxim. Plants Inflammation/Immunology Disease Research Fields	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis
Peimisine (Ebeiensine) hydrochloride is a muscarinic M receptor antagonist and **angiotensin converting enzyme** (ACE) inhibitor. Peimisine hydrochloride shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .

HY-N0214

Peimisine 3 Publications Verification Ebeiensine	Alkaloids Piperidine Alkaloids Structural Classification Liliaceae Classification of Application Fields Source classification Plants Inflammation/Immunology Disease Research Fields Fritillaria cirrhosa	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis
Peimisine (Ebeiensine) is a muscarinic M receptor antagonist and **angiotensin converting enzyme** (ACE) inhibitor. Peimisine shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .

HY-N4090R

Vicenin 3 (Standard)	Structural Classification Flavonoids other families Flavones Leguminosae Source classification Phenols Polyphenols Plants Desmodium styracifolium (Osbeck.) Merr.	Angiotensin-converting Enzyme (ACE)
Vicenin 3 (Standard) is the analytical standard of Vicenin 3. This product is intended for research and analytical applications. Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium .

HY-N2165R

Vicenin 2 (Standard)	Cardiovascular Disease Structural Classification Flavonoids Classification of Application Fields Leguminosae Source classification Phenols Plants Disease Research Fields Desmodium styracifolium (Osbeck.) Merr.	Angiotensin-converting Enzyme (ACE)
Vicenin 2 (Standard) is the analytical standard of Vicenin 2. This product is intended for research and analytical applications. Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=43.83 μM) from the aerial parts of Desmodium styracifolium .

HY-N11970

Isocrenatoside	Structural Classification Labiatae Source classification Phenols Polyphenols Plants Achillea atrata L.	Angiotensin-converting Enzyme (ACE)
Isocrenatoside (compound 6) is a cyclic octapeptide and an inhibitor of angiotensin-converting enzyme (ACE). Isocrenatoside is isolated from the ethanolic extract of Microtoena prainiana stems. Studies have found that the inhibitory efficiency of 1 mg/mL Isocrenatoside can reach 99.3% .

HY-130199

Psoromic acid Parellic acid	Structural Classification Microorganisms Classification of Application Fields Ketones, Aldehydes, Acids Source classification Metabolic Disease Disease Research Fields	Others
Psoromic acid is a potent and selective RabGGTase (Rab geranylgeranyl transferase) inhibitor with an IC₅₀ value of 1.3 µM. Psoromic acid is an antioxidative agent. Psoromic acid exhibits a competitive type of HMGR inhibition and mixed type of ACE (angiotensin converting enzyme) inhibition .

HY-N2165

Vicenin 2 5 Publications Verification	Cardiovascular Disease Structural Classification Flavonoids Classification of Application Fields Flavones Leguminosae Phenols Polyphenols Plants Disease Research Fields Desmodium styracifolium (Osbeck.) Merr.	Angiotensin-converting Enzyme (ACE)
Vicenin 2, a flavonoid, is an orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀ of 43.83 μM) . Vicenin 2 has radioprotective, anti-nociceptive effects, anti-glycation anti-inflammatory, antioxidant, anticancer, antiangiogenic properties .

HY-B0130

Perindopril 5+ Cited Publications S-9490	Cardiovascular Disease Classification of Application Fields Disease Research Fields	Angiotensin-converting Enzyme (ACE) NF-κB STAT Sirtuin
Perindopril erbumine is an **angiotensin-converting enzyme** inhibitor. Perindopril erbumine modulates NFκB and STAT3 signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure .

HY-107339

Deserpidine Harmonyl	Apocynaceae Alkaloids Piperidine Alkaloids Structural Classification Plants Rauwolfia canescens Indole Alkaloids	Angiotensin-converting Enzyme (ACE)
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex .

HY-N2021

Phosphoramidon	Structural Classification Microorganisms Ketones, Aldehydes, Acids	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite
Phosphoramidon, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively .

HY-A0115

Ramiprilat HOE 498 diacid; Ramipril diacid	Cardiovascular Disease Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Drug Metabolite Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a K_i value of 7 pM. Ramiprilat has acute antlhypertensive effect. Ramiprilat can be used for high blood pressure and heart failure research .

HY-A0116R

Trandolaprilate (Standard)	Structural Classification Alkaloids Pyrrole Alkaloids Source classification Endogenous metabolite	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Trandolaprilate (Standard) is the analytical standard of Trandolaprilate. This product is intended for research and analytical applications. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-N7450

Icariside D2	Infection Structural Classification Natural Products Classification of Application Fields Source classification Plants Annonaceae Inflammation/Immunology Disease Research Fields Annona glabra Linn.	Angiotensin-converting Enzyme (ACE) Apoptosis HIV
Icariside D2, isolated from Annona glabra fruit, inhibits **angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC₅₀** value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .

HY-N2021A

Phosphoramidon disodium	Cardiovascular Disease Alkaloids Structural Classification Microorganisms Classification of Application Fields Source classification Disease Research Fields Indole Alkaloids Cancer	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite
Phosphoramidon disodium, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon disodium also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively .

HY-N0214R

Peimisine (Standard)	Alkaloids Piperidine Alkaloids Structural Classification Liliaceae Source classification Plants Fritillaria cirrhosa	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis
Peimisine (Standard) is the analytical standard of Peimisine. This product is intended for research and analytical applications. Peimisine (Ebeiensine) is a muscarinic M receptor antagonist and angiotensin converting enzyme (ACE) inhibitor. Peimisine shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .

HY-N2298

Camellianin A	Structural Classification Adinandra nitida Merr. ex Li Flavonoids Classification of Application Fields Flavones Source classification Phenols Polyphenols Plants Disease Research Fields Theaceae Cancer	Apoptosis
Camellianin A, the main flavonoid in A. nitida leaves, displays anticancer activity and angiotensin converting enzyme (ACE)-inhibitory activity. Camellianin A inhibits the proliferation of the human Hep G2 and MCF-7 cell lines and induces the significant increase of the G0/G1 cell population .

HY-107339R

Deserpidine (Standard)	Apocynaceae Alkaloids Piperidine Alkaloids Structural Classification Plants Rauwolfia canescens Indole Alkaloids	Angiotensin-converting Enzyme (ACE)
Deserpidine (Standard) is the analytical standard of Deserpidine. This product is intended for research and analytical applications. Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex .

HY-121858

Nicotianamine	Structural Classification Nicotiana tabacum L. Ketones, Aldehydes, Acids Source classification Solanaceae Plants	Angiotensin-converting Enzyme (ACE)
Nicotianamine can be isolated from the leaves of Nicotiana Tabacum L.. Nicotianamine is a key biosynthetic precursor of phytosiderophores. Nicotianamine is an iron chelating agent and can promote the transport of iron. Nicotianamine is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ values of 76 nM and 59 nM for rhACE2 and rhACE, respectively. Nicotianamine is vital in metal nutrition and metal homeostasis of flowering plants .

HY-B0093

Benazepril CGS14824A free base	Cardiovascular Disease Classification of Application Fields Disease Research Fields	Angiotensin-converting Enzyme (ACE) Apoptosis Reactive Oxygen Species
Benazepril (CGS14824A free base) is an orally active angiotensin-converting enzyme (ACE) inhibitor to reduce angiotensin-II production. Benazepril inhibits oxidative stress and inhibits apoptosis by the PI3K/Akt signaling pathway. Benazepril improves diabetic nephropathy and decreases proteinuria. Benazepril can be used in the study of hypertension, heart failure and diabetic nephropathy .

HY-N2533

Cyanidin 3-sambubioside chloride Cyanidin-3-O-sambubioside chloride	Infection Structural Classification Anthocyans Flavonoids other families Classification of Application Fields Source classification Phenols Polyphenols Plants Inflammation/Immunology Disease Research Fields	Influenza Virus Angiotensin-converting Enzyme (ACE) Akt MMP
Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC₅₀ of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties .

HY-N2533R

Cyanidin 3-sambubioside chloride (Standard) Cyanidin-3-O-sambubioside chloride (Standard)	Structural Classification Anthocyans Flavonoids other families Source classification Phenols Polyphenols Plants	Reference Standards Influenza Virus Angiotensin-converting Enzyme (ACE) Akt MMP
Cyanidin 3-sambubioside (chloride) (Standard) is the analytical standard of Cyanidin 3-sambubioside (chloride). This product is intended for research and analytical applications. Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC50 of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties .

HY-14393

Emodin Maximum Cited Publications 24 Publications Verification Frangula emodin	Structural Classification Classification of Application Fields Polygonaceae Source classification Plants Endogenous metabolite Quinones Human Gut Microbiota Metabolites Microorganisms Rheum palmatum L. Anthraquinones Phenols Polyphenols Disease Research Fields Cancer	SARS-CoV Casein Kinase Autophagy 11β-HSD
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

HY-A0181AR

Adenosine 5'-monophosphate (monohydrate) (Standard)	Structural Classification Ketones, Aldehydes, Acids Source classification Endogenous metabolite	Endogenous Metabolite Adenosine Receptor HSV
Cyanidin 3-sambubioside (chloride) (Standard) is the analytical standard of Cyanidin 3-sambubioside (chloride). This product is intended for research and analytical applications. Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC50 of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties .

HY-14393R

Emodin (Standard) Frangula emodin (Standard)	Quinones Structural Classification Rheum palmatum L. Classification of Application Fields Polygonaceae Source classification Phenols Plants Disease Research Fields Cancer	SARS-CoV Casein Kinase Autophagy 11β-HSD
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

Cat. No.	Product Name	Chemical Structure

HY-B0331AS

Enalapril D5 maleate
Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.

HY-B0231AS

Enalaprilat-d5
Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-B0231BS

Enalaprilat-d5 sodium
Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-108321S

Zofenopril-d5
Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.

HY-B0279S

Ramipril-d5
Ramipril-d₅ is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-18206S

Lisinopril-d5
Lisinopril-d₅ is the deuterium labeled Lisinopril. Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-A0116S

Trandolaprilate-d5
Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].

HY-107337S

Delapril-d3 hydrochloride
Delapril-d₃ (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases[1].

HY-B0279S1

Ramipril-d3
Ramipril-d₃ is the deuterium labeled Ramipril[1]. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-B0279S2

Ramipril-d4
Ramipril-d₄ is deuterated labeled Ramipril (HY-B0279). Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-B0592S

Trandolapril-d5
Trandolapril-d₅ is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].

HY-109592S

Imidaprilate-d5
Imidaprilate-d₅ is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.

HY-117281S

Moexipril-d5
Moexipril-d₅ is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure[1][2].

HY-B1451S

Imidapril-d3 hydrochloride
Imidapril-d₃ (hydrochloride) (TA-6366-d3) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].

HY-117281S1

Moexipril-d3
Moexipril-d₃ is deuterated labeled Moexipril (HY-117281). Moexipril is an orally active inhibitor of **angiotensin-converting enzyme (ACE**), and becomes effective by being hydrolyzed to moexiprila hydrochloride. Moexipril exhibits antihypertensive and neuroprotective effects ^- .

HY-B0331S1

Enalapril-d3
Enalapril-d₃ (MK-421-d₃) is deuterium labeled Enalapril. Enalapril (MK-421) is an angiotensin-converting enzyme (ACE) inhibitor, can be used for hypertensive diseases research .

HY-18206S1

(S)-Lisinopril-d5 sodium
(S)-Lisinopril-d₅ (sodium) (MK-521-d₅ (sodium)) is deuterium labeled Lisinopril. Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-100713S

Temocapril-d5
Temocapril-d₅ is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].

HY-W739949

Imidaprilat-d3
Imidaprilat-d₃ (6366A-d₃) is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC₅₀ of 2.6 nM, and is used in the research of hypertensive disease .

HY-B1433S

Perindoprilat-d3 disodium
Perindoprilat-d₃ disodium is deuterated labeled Perindoprilat (HY-B1433). Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .

HY-A0115S1

Ramiprilat-d5
Ramiprilat-d₅ is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research[1].

HY-18206S2

Lisinopril-13C5,15N
Lisinopril- ¹³C₅, ¹⁵N (MK-521- ¹³C₅, ¹⁵N) is ¹³C and ¹⁵N labeled Lisinopril. Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-A0116S1

Trandolaprilate-d6
Trandolaprilate-d₆ is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].

HY-A0115S2

Ramiprilat-d4 hydrochloride
Ramiprilat-d₄ hydrochloride is deuterated labeled Ramiprilat (HY-A0115). Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

HY-B0690S

Fosinopril-d5
Fosinopril-d₅ (SQ28555-d₅ (free acid)) is deuterium labeled Fosinopril. Fosinopril (SQ28555 free acid) is the ester proagent of **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ value of 0.18 μM. Fosinopril demonstrates a non-competitive inhibition effect on ACE activity with an K_i** value of 1.675 μM .

HY-B0130AS

Perindopril-d3 erbumine
Perindopril-d₃ (erbumine) is deuterated labeled Perindopril (erbumine) (HY-B0130A). Perindopril erbumine is an **angiotensin-converting enzyme inhibitor. Perindopril erbumine modulates NF-κB and STAT3** signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure .

HY-B0592S2

rac-Trandolapril-d5

rac-Trandolapril-d₅ (rac-RU44570-d₅) is deuterium labeled Trandolapril. Trandolapril (RU44570) is a nonsulfhydryl proagent that is hydrolysed to the active diacid Trandolaprilat. Trandolapril is an orally administered angiotensin converting enzyme (ACE) inhibitor that has been used in the treatment of hypertension and congestive heart failure (CHF), and after myocardial infarction (MI) .

HY-B0477AS2

Quinapril-d4

Quinapril-d₄ (CI-906-d₄) is deuterium labeled Quinapril. Quinapril is a potent, orally active, non-peptide and nonsulfhydryl inhibitor of angiotensin-converting enzyme (ACE). Quinapril specifically interrupts the conversion of angiotensin I to angiotensin II in both plasma and tissue. Quinapril is enzymatically hydrolyzed to a pharmacologically active diacid form quinaprilat. Quinapril is efficacious in hypertensive models .

HY-P1032S2

Angiotensin I-13C6,15N (human, mouse, rat) TFA
Angiotensin I-13C6,15N (human, mouse, rat) TFA is ¹³C and ¹⁵N labeled Angiotensin I (human, mouse, rat) TFA. Angiotensin I-13C6,15N (human, mouse, rat) TFA is a precursor of angiotensin II and is cleaved into angiotensin II by angiotensin converting enzyme (ACE) .

HY-B0093AS

Benazepril-d5 hydrochloride

Benazepril-d₅ hydrochloride is deuterium labeled Benazepril hydrochloride. Benazepril hydrochloride is an orally active angiotensin-converting enzyme (ACE) inhibitor to reduce angiotensin-II production. Benazepril hydrochloride inhibits oxidative stress and inhibits apoptosis by the PI3K/Akt signaling pathway. In addition, Benazepril hydrochloride improves diabetic nephropathy and decreases proteinuria. Benazepril hydrochloride can be used in the study of hypertension, heart failure and diabetic nephropathy .

HY-B0368S

Captopril-d3
Captopril-d₃ is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].

HY-B0130S1

Perindopril-d5

Perindopril-d₅ (S-9490-d₅) is deuterium labeled Perindopril. Perindopril (S-9490) is an orally available, long-acting angiotensin-converting enzyme (ACE) inhibitor. Perindopril inhibits inflammatory cell influx and intimal thickening, preserving elastin on the inside of the aorta. Perindopril effectively inhibits experimental abdominal aortic aneurysm (AAA) formation in a rat model and reduces pulmonary vasoconstriction in rats with pulmonary hypertension .

HY-B0368S1

Captopril-13C5,15N

Captopril- ¹³C₅, ¹⁵N (SQ 14225- ¹³C₅, ¹⁵N) is ¹³C and ¹⁵N labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC₅₀ of 7.9 μM .

HY-14393S

Emodin-d4

Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks