1. GPCR/G Protein Neuronal Signaling
  2. CGRP Receptor
  3. Adrenotensin (human)

Adrenotensin (human)  (Synonyms: Pro-ADM-153-185 (human))

Cat. No.: HY-P3919
Handling Instructions Technical Support

Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Adrenotensin (human)

Adrenotensin (human) Chemical Structure

CAS No. : 166546-72-1

Size Stock
50 mg   Get quote  
100 mg   Get quote  
250 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Adrenotensin (human) (Pro-ADM-153-185 (human)) is a 153-185 fragment of precursor peptide of Adrenomedullin. Adrenomedullin (ADM) is a 52-amino acid multifunctional peptide, which belongs to the CGRP superfamily of vasoactive peptide hormones[1].

In Vitro

The human Adrenomedullin (ADM) peptide is encoded by a single gene, which is located on chromosome 11 and consists of four exons and three introns. Translation of the transcript generates the 185 amino acid precursor peptide prepro-ADM, which is subsequently converted into the 164 amino acid pro-ADM by cleavage of the N-terminal signal-peptide. Pro-ADM is further processed into proADM N-terminal 20 peptide (PAMP), midregional pro-ADM, Adrenotensin Pro-ADM-153-185 and immature ADM, a C-terminally glycine-extended version of ADM[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Molecular Weight

3219.56

Formula

C143H224N42O43

CAS No.
Sequence

Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu

Sequence Shortening

SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Adrenotensin (human)
Cat. No.:
HY-P3919
Quantity:
MCE Japan Authorized Agent: