1. Signaling Pathways
  2. GPCR/G Protein
  3. GCGR

GCGR

Glucagon Receptor

GCGR (glucagon receptor) is in the G protein-coupled receptor family, that is important in controlling blood glucose levels. The glucagon receptor is a 62 kDa protein that is activated by glucagon and is a member of the class B G-protein coupled family of receptors, coupled to G alpha i, Gs and to a lesser extent G alpha q. Stimulation of the receptor results in activation of adenylate cyclase and increased levels of intracellular cAMP. In humans, the glucagon receptor is encoded by the GCGR gene. Glucagon receptors are mainly expressed in liver and in kidney with lesser amounts found in heart, adipose tissue, spleen, thymus, adrenal glands, pancreas, cerebral cortex, and gastrointestinal tract.

Cat. No. Product Name Effect Purity Chemical Structure
  • HY-P10019
    Pegsebrenatide
    Agonist
    Pegsebrenatide (NLY01) is a long-acting GLP-1R agonist. Pegsebrenatide has an extended half-life and favorable blood-brain barrier penetration. Pegsebrenatide can block A1 astrocyte transformation, reducing dopaminergic cell death, and improving motor symptoms in mouse models of PD.
    Pegsebrenatide
  • HY-116819A
    VU0453379 hydrochloride
    Modulator ≥99.0%
    VU0453379 hydrochloride is a highly selective and central nervous system (CNS) penetrant positive allosteric modulator (PAM) of glucagon-like peptide-1R (GLP-1R) with an EC50 of 1.3 μM.
    VU0453379 hydrochloride
  • HY-10036
    Glucagon receptor antagonist-1
    Antagonist 98.65%
    Glucagon receptor antagonist-1 is a highly potent glucagon receptor antagonist.
    Glucagon receptor antagonist-1
  • HY-P3622
    (Ser8)-GLP-1 (7-36) amide, human
    Agonist 99.10%
    (Ser8)-GLP-1 (7-36) amide, human is a glucagon-like peptide 1 amide derived from glucagonogen, a cleavage product of the GLP-1 (1-36) amide peptide. (Ser8)-GLP-1 (7-36) amide, human is an entero-insulinotropic hormone that causes glucose-dependent release of insulin from pancreatic β-cells and affects gastrointestinal motility and secretion.
    (Ser8)-GLP-1 (7-36) amide, human
  • HY-P5815A
    GLP-1 (1-36) amide (human, rat) TFA
    98.81%
    GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat) ) TFA is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) TFA can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells.
    GLP-1 (1-36) amide (human, rat) TFA
  • HY-P990013
    Gulgafafusp alfa
    Inhibitor
    Gulgafafusp alfa is a human IgG2κ antibody targeting the glucagon-like peptide 1 receptor GLP1R.
    Gulgafafusp alfa
  • HY-P2497
    Exendin (5-39)
    Antagonist 99.43%
    Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats.
    Exendin (5-39)
  • HY-124803
    GPCR modulator-1
    Modulator
    GPCR modulator-1 is a negative allosteric modulator of GLP receptor. GPCR modulator-1 has the potential for type 2 diabetes research.
    GPCR modulator-1
  • HY-119739
    Skyrin
    Antagonist
    Skyrin is an anthraquinone compound that can be isolated from almond fruit. Skyrin is a receptor-selective glucagon antagonist. Skyrin can inhibit the growth of tumor cells.
    Skyrin
  • HY-P10031
    SAR441255
    Agonist 99.77%
    SAR441255 is a potent unimolecular peptide GLP-1/GIP/GCG receptor triagonist. SAR441255 displays high potency with balanced activation of all three target receptors.?SAR441255 shows positive acute glucoregulatory effectss in diabetic obese monkeys.
    SAR441255
  • HY-145458
    GLP-1 receptor agonist 9
    Agonist 99.70%
    GLP-1 receptor agonist 9 is a GLP-1 receptor agonist, example 7, extracted from WO2020234726 A1.
    GLP-1 receptor agonist 9
  • HY-P1231
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
    99.03%
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.
    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • HY-P1226
    HAEGTFTSD
    Agonist 98.48%
    HAEGTFTSD is a 9-residue peptide of human GLP-1 peptide or GLP-1(7-36), amide (HY-P0054A). GLP-1(7-36), amide is a physiological incretin hormone that stimulates insulin secretionin a glucose-dependant manner
    HAEGTFTSD
  • HY-P3617
    Glucagon (22-29)
    Agonist 99.69%
    Glucagon (22-29) is partial agonist of Glucagon (19–29). Glucagon specifically inhibits the Ca2+ pump in liver plasma membranes independently of adenylate cyclase activation.
    Glucagon (22-29)
  • HY-P1224
    HAEGTFTSDVS
    98.62%
    HAEGTFTSDVS is the first N-terminal 1-11 residues of GLP-1 peptide.
    HAEGTFTSDVS
  • HY-P10341
    ZP3022
    Agonist
    ZP3022 is a dual agonist of glucagon-like peptide-1 (GLP-1) and gastrin that has the ability to sustainably improve glycemic control. Additionally, ZP3022 can effectively increase β-cell mass, promote β-cell proliferation, and enhance the function of pancreatic islets. ZP3022 can be used in anti-diabetic research.
    ZP3022
  • HY-147622
    GLP-1R agonist 9
    Agonist
    GLP-1R agonist 9 (Compound 96) is a GLP-1R agonist with EC50 values of 1.1 nM and 11 nM against CHO GLP-1R Clone H6 and CHO GLP-1R Clone C6, respectively.
    GLP-1R agonist 9
  • HY-P10032
    NN1177
    Agonist 99.77%
    NN1177 is a long-acting GLP-1/glucagon receptor co-agonist. NN1177 can induce a dose-dependent body weight loss in diet-induced obese (DIO) mice.
    NN1177
  • HY-P5815
    GLP-1 (1-36) amide (human, rat)
    GLP-1 (1-36) amide (human, rat) (Glucagon-like Peptide 1 (1-36) amide (human, rat) ) is a molecular variant of glucagon-like peptide 1 (GLP-1)-(7-36) amide. GLP-1 (1-36) amide (human, rat) can stimulate [14C]aminopyrine accumulation on enzymatically dispersed enriched rat parietal cells.
    GLP-1 (1-36) amide (human, rat)
  • HY-P1227
    SDV-Exendin-3/4
    SDV-Exendin-3/4 is a 32-amino acid peptide.
    SDV-Exendin-3/4
Cat. No. Product Name / Synonyms Species Source
Cat. No. Product Name / Synonyms Application Reactivity